KEGG   Dehalobacter sp. CF: DCF50_p584Help
Entry
DCF50_p584        CDS       T02279                                 

Definition
Tryptophan synthase alpha chain (EC:4.2.1.20)
Orthology
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
dec  Dehalobacter sp. CF
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:dec00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    DCF50_p584
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    DCF50_p584
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    DCF50_p584
Enzymes [BR:dec01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     DCF50_p584
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
590771..591553
Genome map
AA seq 260 aa AA seqDB search
MQIEKQIEAMRKEKKILLMTHQIIGYPDFAANEKVIECFYNNGVDLIELQIPFSDPIADG
PVFTKSNQAVLEKGIKVSNCLKFIERMASKYPIPFLVMTYYNILYQYGVEAFIDRCKEIG
VQGTIVPDAPLDEARAYYDYSRQQGLAAVSIATPYSDPKRLQEIADIGSGFIYYVPRKGV
TGSKTTFDSEILDGIQKAKKETGKTIAVGFGIQGPEDVARLIGTADIAIIGSKIQQVLET
EGLSGLDQFLGDMARVNKEE
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atgcagattgaaaaacaaattgaagctatgagaaaagagaagaaaatactgctgatgacc
caccaaattattggctatcctgattttgccgccaatgaaaaagtgattgaatgcttttat
aacaacggggtcgacctgattgaactgcaaatacctttttctgatccgattgctgacgga
ccggtattcaccaagtccaaccaggccgtattggaaaaagggattaaagtcagcaactgc
ctgaagtttattgagagaatggccagcaaatacccgatcccgtttttggtcatgacctac
tacaatattctgtaccaatacggcgtcgaagcatttattgaccggtgcaaagagattggc
gtccagggaaccatcgtgccggatgctccgcttgatgaggccagagcctactacgattat
tcccgccaacagggattggctgcagtaagtatagcgacaccttattccgatccgaagcga
ctgcaggaaattgcagatatcgggagcggattcatctattacgttccccgcaaaggggta
accggcagcaaaacaacttttgactctgaaattttggacggaatccaaaaagcaaagaaa
gagaccggcaaaacaatcgccgtaggtttcgggattcaaggcccggaagatgtcgcccgt
ttaattggaactgccgatatagcgatcatcggcagtaagatccagcaggtgcttgagact
gaagggctgtccggtctggatcagtttttaggcgatatggcgcgtgttaataaggaggaa
tga

DBGET integrated database retrieval system