KEGG   Dehalobacter sp. CF: DCF50_p584Help
Entry
DCF50_p584        CDS       T02279                                 

Definition
(GenBank) Tryptophan synthase alpha chain (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
dec  Dehalobacter sp. CF
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:dec00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    DCF50_p584
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    DCF50_p584
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    DCF50_p584
Enzymes [BR:dec01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     DCF50_p584
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
590771..591553
Genome map
AA seq 260 aa AA seqDB search
MQIEKQIEAMRKEKKILLMTHQIIGYPDFAANEKVIECFYNNGVDLIELQIPFSDPIADG
PVFTKSNQAVLEKGIKVSNCLKFIERMASKYPIPFLVMTYYNILYQYGVEAFIDRCKEIG
VQGTIVPDAPLDEARAYYDYSRQQGLAAVSIATPYSDPKRLQEIADIGSGFIYYVPRKGV
TGSKTTFDSEILDGIQKAKKETGKTIAVGFGIQGPEDVARLIGTADIAIIGSKIQQVLET
EGLSGLDQFLGDMARVNKEE
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atgcagattgaaaaacaaattgaagctatgagaaaagagaagaaaatactgctgatgacc
caccaaattattggctatcctgattttgccgccaatgaaaaagtgattgaatgcttttat
aacaacggggtcgacctgattgaactgcaaatacctttttctgatccgattgctgacgga
ccggtattcaccaagtccaaccaggccgtattggaaaaagggattaaagtcagcaactgc
ctgaagtttattgagagaatggccagcaaatacccgatcccgtttttggtcatgacctac
tacaatattctgtaccaatacggcgtcgaagcatttattgaccggtgcaaagagattggc
gtccagggaaccatcgtgccggatgctccgcttgatgaggccagagcctactacgattat
tcccgccaacagggattggctgcagtaagtatagcgacaccttattccgatccgaagcga
ctgcaggaaattgcagatatcgggagcggattcatctattacgttccccgcaaaggggta
accggcagcaaaacaacttttgactctgaaattttggacggaatccaaaaagcaaagaaa
gagaccggcaaaacaatcgccgtaggtttcgggattcaaggcccggaagatgtcgcccgt
ttaattggaactgccgatatagcgatcatcggcagtaagatccagcaggtgcttgagact
gaagggctgtccggtctggatcagtttttaggcgatatggcgcgtgttaataaggaggaa
tga

DBGET integrated database retrieval system