KEGG   Dehalobacter sp. CF: DCF50_p586Help
Entry
DCF50_p586        CDS       T02279                                 

Definition
(GenBank) Indole-3-glycerol phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
dec  Dehalobacter sp. CF
Pathway
dec00400  Phenylalanine, tyrosine and tryptophan biosynthesis
dec01100  Metabolic pathways
dec01110  Biosynthesis of secondary metabolites
dec01130  Biosynthesis of antibiotics
dec01230  Biosynthesis of amino acids
Module
dec_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:dec00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    DCF50_p586
Enzymes [BR:dec01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     DCF50_p586
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS FMN_dh QRPTase_C
Motif
Other DBs
NCBI-ProteinID: AFV04592
UniProt: K4KZV1
Position
592681..593532
Genome map
AA seq 283 aa AA seqDB search
MILDKIVEAKIKRLSDQKKKISGEELIEKLTKKLKINDDRDNLKHDVNMERPAGVFASAL
TAGRLSKEKAGISIIAEVKKASPSKGILAPDFDYLQIASMYEQLGAAAISVLTEQDYFLG
SPDYLREIRESVKIPLLRKDFMIDPYQIYEAKILGADAILLIVKILDDQQLKEYLGIAEQ
IGLDCLVEVHNEAEAERAMAAGAGIIGINNRNLETFEVDLNHSRRIGAMVPDHLIKVSES
GIHTGEDILTAQAWGFDAVLVGEAFMKAGSLEQKFAELLFGIF
NT seq 852 nt NT seq  +upstreamnt  +downstreamnt
atgatccttgataaaattgtagaggccaaaataaaacggctttccgatcagaagaaaaaa
atttccggcgaagagctcatcgaaaagctaacaaaaaaactaaaaatcaatgatgatcgt
gataatcttaagcatgatgttaacatggagcggcctgcaggcgtctttgcctcagccctg
actgcgggacgcctgagcaaagaaaaagcagggatttccataatcgcggaagtcaagaaa
gcttctccatccaaaggaatcctggctccggacttcgattatctgcaaatagccagcatg
tatgaacagctgggggctgcggcaatctccgtcttaacagagcaggattactttctcggg
agtccggattatctgagggaaattagagaatccgtcaagattccgctgctgcgaaaggat
tttatgattgacccttatcagatttacgaagcaaagattttgggggcggatgctattctg
ctcatcgtaaaaatattagatgatcagcagctgaaagaatatcttggaatagctgaacag
atcggcctggattgtcttgtggaagtgcataacgaagcagaagctgaaagggccatggca
gcaggagccggcatcatcggaatcaataaccggaacctggagacgtttgaggtggatttg
aaccacagccgcagaatcggcgcgatggtcccggatcatctgatcaaggtctcagaaagc
gggattcatacgggcgaggatatcctaacggcgcaagcgtggggatttgatgctgttctg
gtcggagaggcttttatgaaggcaggcagtcttgaacaaaaatttgctgagctcctcttc
gggatattctga

DBGET integrated database retrieval system