KEGG   Dehalobacter sp. CF: DCF50_p586Help
Entry
DCF50_p586        CDS       T02279                                 

Definition
Indole-3-glycerol phosphate synthase (EC:4.1.1.48)
Orthology
K01609  
indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
dec  Dehalobacter sp. CF
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:dec00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    DCF50_p586
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    DCF50_p586
Enzymes [BR:dec01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     DCF50_p586
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
592681..593532
Genome map
AA seq 283 aa AA seqDB search
MILDKIVEAKIKRLSDQKKKISGEELIEKLTKKLKINDDRDNLKHDVNMERPAGVFASAL
TAGRLSKEKAGISIIAEVKKASPSKGILAPDFDYLQIASMYEQLGAAAISVLTEQDYFLG
SPDYLREIRESVKIPLLRKDFMIDPYQIYEAKILGADAILLIVKILDDQQLKEYLGIAEQ
IGLDCLVEVHNEAEAERAMAAGAGIIGINNRNLETFEVDLNHSRRIGAMVPDHLIKVSES
GIHTGEDILTAQAWGFDAVLVGEAFMKAGSLEQKFAELLFGIF
NT seq 852 nt NT seq  +upstreamnt  +downstreamnt
atgatccttgataaaattgtagaggccaaaataaaacggctttccgatcagaagaaaaaa
atttccggcgaagagctcatcgaaaagctaacaaaaaaactaaaaatcaatgatgatcgt
gataatcttaagcatgatgttaacatggagcggcctgcaggcgtctttgcctcagccctg
actgcgggacgcctgagcaaagaaaaagcagggatttccataatcgcggaagtcaagaaa
gcttctccatccaaaggaatcctggctccggacttcgattatctgcaaatagccagcatg
tatgaacagctgggggctgcggcaatctccgtcttaacagagcaggattactttctcggg
agtccggattatctgagggaaattagagaatccgtcaagattccgctgctgcgaaaggat
tttatgattgacccttatcagatttacgaagcaaagattttgggggcggatgctattctg
ctcatcgtaaaaatattagatgatcagcagctgaaagaatatcttggaatagctgaacag
atcggcctggattgtcttgtggaagtgcataacgaagcagaagctgaaagggccatggca
gcaggagccggcatcatcggaatcaataaccggaacctggagacgtttgaggtggatttg
aaccacagccgcagaatcggcgcgatggtcccggatcatctgatcaaggtctcagaaagc
gggattcatacgggcgaggatatcctaacggcgcaagcgtggggatttgatgctgttctg
gtcggagaggcttttatgaaggcaggcagtcttgaacaaaaatttgctgagctcctcttc
gggatattctga

DBGET integrated database retrieval system