KEGG   Dehalobacter sp. CF: DCF50_p646Help
Entry
DCF50_p646        CDS       T02279                                 

Definition
Cellulase M-related protein (EC:3.4.11.-)
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
dec  Dehalobacter sp. CF
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dec00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    DCF50_p646
Enzymes [BR:dec01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     DCF50_p646
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
652888..653940
Genome map
AA seq 350 aa AA seqDB search
MLRNSFELARELTCSLTEMTGVSGYEQGLKTTLQDIFVPLSTETFSDFIGNFYAVKKGEH
SGKHSVMLAAHIDEIGLMITHIDERGFLHFVTLGGIDQRTLLYQEILVHGKEELRGVVCL
GSSHKDSKKQQTLDIEDLVIDIGFNDAAAVQMVKPGDIASIKRCPLHLLNDRISGKALDD
RAGVAVLAVCLNELMGMKHQHDVVAVATVQEEVGLRGGLTSSERLLPSLAVAVDVTHAQT
LDTKSQVSAELAKGPVISLGPNIHPWVYARLSDSAQQNRIACQRQAVPGATGTDARVIQL
TGYGIPTGLVSIPLRYMHTSVETASLQDIVECGKLLAYFIASLPEELEEL
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
gtgttaaggaactccttcgagcttgcgcgggaacttacctgttcgttaacggaaatgaca
ggtgtttccgggtatgaacagggcttaaaaacaacacttcaggatatttttgtgccacta
tcgacagagactttctctgattttatcggcaatttctatgcggttaaaaaaggagaacac
agcgggaaacattccgtaatgcttgctgcccatatcgacgagatcggattgatgatcacc
catattgatgaaagaggatttttacactttgtcacgctcggcggaattgaccagagaacc
ttgctttaccaggaaatcctggtacacggaaaggaagagctgcggggcgtagtttgcctg
ggatcttcccacaaggacagcaaaaaacagcagaccctcgatatagaggatctggtgatc
gatatcggttttaatgatgcagcggcagttcaaatggtcaaaccgggagatatcgccagc
atcaaaagatgcccactgcatctgctcaacgacagaatatccggcaaagcgcttgacgac
agagctggagtcgcagtactggctgtatgcctgaacgaactgatgggtatgaaacatcag
catgatgtggtagcggtcgctacggttcaggaagaagtgggtttaagaggagggcttacc
agctcagagcgacttctgccgtcgctggcagttgccgttgatgtgacgcatgcccaaacg
ctggataccaaaagtcaggtttccgctgaactggcgaaaggaccggtgatcagtctcggt
ccgaatatccatccctgggtctacgccaggctctccgacagtgcacagcagaacaggatt
gcctgtcagcggcaggcggtccccggggcaacaggcaccgatgccagagtaattcagctg
accggttatggtataccgaccgggctggtctccatacctctccggtatatgcatacgtcc
gtcgagacggcctcgctgcaggatattgttgaatgcggcaagctgctggcgtatttcatt
gcgtcgttgccggaagaattggaggaactctaa

DBGET integrated database retrieval system