KEGG   Dehalobacter sp. CF: DCF50_p646Help
Entry
DCF50_p646        CDS       T02279                                 

Definition
(GenBank) Cellulase M-related protein (EC:3.4.11.-)
Organism
dec  Dehalobacter sp. CF
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
652888..653940
Genome map
AA seq 350 aa AA seqDB search
MLRNSFELARELTCSLTEMTGVSGYEQGLKTTLQDIFVPLSTETFSDFIGNFYAVKKGEH
SGKHSVMLAAHIDEIGLMITHIDERGFLHFVTLGGIDQRTLLYQEILVHGKEELRGVVCL
GSSHKDSKKQQTLDIEDLVIDIGFNDAAAVQMVKPGDIASIKRCPLHLLNDRISGKALDD
RAGVAVLAVCLNELMGMKHQHDVVAVATVQEEVGLRGGLTSSERLLPSLAVAVDVTHAQT
LDTKSQVSAELAKGPVISLGPNIHPWVYARLSDSAQQNRIACQRQAVPGATGTDARVIQL
TGYGIPTGLVSIPLRYMHTSVETASLQDIVECGKLLAYFIASLPEELEEL
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
gtgttaaggaactccttcgagcttgcgcgggaacttacctgttcgttaacggaaatgaca
ggtgtttccgggtatgaacagggcttaaaaacaacacttcaggatatttttgtgccacta
tcgacagagactttctctgattttatcggcaatttctatgcggttaaaaaaggagaacac
agcgggaaacattccgtaatgcttgctgcccatatcgacgagatcggattgatgatcacc
catattgatgaaagaggatttttacactttgtcacgctcggcggaattgaccagagaacc
ttgctttaccaggaaatcctggtacacggaaaggaagagctgcggggcgtagtttgcctg
ggatcttcccacaaggacagcaaaaaacagcagaccctcgatatagaggatctggtgatc
gatatcggttttaatgatgcagcggcagttcaaatggtcaaaccgggagatatcgccagc
atcaaaagatgcccactgcatctgctcaacgacagaatatccggcaaagcgcttgacgac
agagctggagtcgcagtactggctgtatgcctgaacgaactgatgggtatgaaacatcag
catgatgtggtagcggtcgctacggttcaggaagaagtgggtttaagaggagggcttacc
agctcagagcgacttctgccgtcgctggcagttgccgttgatgtgacgcatgcccaaacg
ctggataccaaaagtcaggtttccgctgaactggcgaaaggaccggtgatcagtctcggt
ccgaatatccatccctgggtctacgccaggctctccgacagtgcacagcagaacaggatt
gcctgtcagcggcaggcggtccccggggcaacaggcaccgatgccagagtaattcagctg
accggttatggtataccgaccgggctggtctccatacctctccggtatatgcatacgtcc
gtcgagacggcctcgctgcaggatattgttgaatgcggcaagctgctggcgtatttcatt
gcgtcgttgccggaagaattggaggaactctaa

DBGET integrated database retrieval system