KEGG   Dehalobacter sp. CF: DCF50_p647Help
Entry
DCF50_p647        CDS       T02279                                 

Definition
Cellulase M-related protein
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
dec  Dehalobacter sp. CF
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dec00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    DCF50_p647
Enzymes [BR:dec01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     DCF50_p647
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
653942..654997
Genome map
AA seq 351 aa AA seqDB search
MLLKELSELNGVSGNEKTVRDFILEHLKYRLQEKLNSCRTDQIGNLLIEKKGIEKGSGEK
MPKVLVCAHMDEIGLMVTEITADGYLKFQTVGGIEPGILIAKTVVFSGGLQGVIGLKAVH
LQKTEERKKIPDVEDLYIDIGASSKAEAENVVKLGDYVTFPTIFEEIGSGLYKGKALDDR
VGCAAIMELLEQDYPCDLTAVFTVQEEVGLRGSKVVSNYLQADLALVVEATRAADFTESE
RENWIVTLGNGPACSLMDSATVYKPGLVQKVMAAAAKNNIPLQFRQGAAAANDAGNIHQA
GIGIPTITLSVPCRNIHTMSSIISKNDYQHCVRLLQCILNDIHDFLNLNIS
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atgctgttaaaagaattatctgaacttaacggcgtatccggtaatgaaaagactgtcagg
gattttattctggaacatcttaaataccgactccaggaaaagttaaattcctgcaggacg
gatcaaatcggaaatctactgatagagaaaaaagggattgaaaaaggttccggtgaaaaa
atgccaaaagtcctggtttgtgcccatatggatgaaatcggcctgatggttacggaaatt
actgcggatggctatctgaagtttcagactgtcggcggtattgaaccggggatcctgata
gctaagactgtcgtattcagcggcggtctgcagggcgtcatcggtttgaaagctgttcat
ttacagaaaacggaggaaagaaaaaaaatcccagatgttgaggatctctacatcgatatc
ggggcatcctcgaaggcagaagcagagaacgttgtgaagctgggcgattacgtcacattc
ccaacaatatttgaagagattggttcaggactgtacaaaggaaaagctcttgatgacagg
gtgggctgtgcggcgatcatggagctcttagaacaggattatccttgtgatctgacagcc
gtattcacagtacaggaggaggtcggcctgcgcggatcgaaagtggtaagcaattatctt
caggctgatctggcactggttgttgaggcgacacgcgctgctgattttactgaatccgaa
cgggaaaactggattgtcacactaggaaacggtccggcctgttcgctgatggattccgca
accgtctataaacctggactcgtccaaaaagtgatggctgcagctgcaaaaaataatatt
ccgctccaattcagacaaggggctgccgcggccaatgatgcaggaaatatccatcaggcc
ggtatcggcatacctacgattacactcagtgtaccctgccggaatattcataccatgagc
tccatcatttcaaagaatgattatcagcactgcgtgcggcttcttcaatgcattttaaat
gacattcacgatttcttaaatcttaatatttcttaa

DBGET integrated database retrieval system