KEGG   Dehalobacter sp. CF: DCF50_p733Help
Entry
DCF50_p733        CDS       T02279                                 

Definition
Acyl-coenzyme A synthetase/AMP-(fatty) acid ligase
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
dec  Dehalobacter sp. CF
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:dec00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    DCF50_p733
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    DCF50_p733
   00620 Pyruvate metabolism
    DCF50_p733
   00640 Propanoate metabolism
    DCF50_p733
  Energy metabolism
   00680 Methane metabolism
    DCF50_p733
Enzymes [BR:dec01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     DCF50_p733
Lipid biosynthesis proteins [BR:dec01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   DCF50_p733
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(752735..754417)
Genome map
AA seq 560 aa AA seqDB search
MNLASRYIGKTDFDSYEDFCANYQVKVPDNFNFAYDIVDEYGRLEPERPALVWCDDHGNE
RIFTFADLKKYSDKTANMLSEAGIRKGDKVMLILRRRYEVYIAILALAKIGAIYIPSSNQ
LTQKDIIYRNNAASIKAIIAYHDPVILDHVEASREESSTLETLFLVGARRPGWVDFDSSM
EAASENWVRPTGADATTNDDTMIIYFTSGTTSMPKMAIQSFTYPLGHIVTAKYWQRVVDG
GLHLTVSDSGWAKFGWGKIYGQWICGAVQFVYDMDKFIPEKLLEMMQKYKLSTFCAPPTI
YRFLLEHNLEKYNLSSIVHCSTAGEPLNPDVFNRFKSITGLSILNGFGQSETTVLVANFE
WLDIYPGAMGKPNPAYKIDVVDENGAPCPPGVEGELVIREADSNKPAGLFCGYYMDETAT
NKVWYDDTYHTGDMAYWDEHGFLWFVGRNDDVIKASGYRISPFEVESALIEHPAVVECAV
TGAPDAVRGTVVKATVVLAKGYTASELLKKEIQDYVKKVTAPYKYPRILEFVDELPKTIG
GKIKRAQIRREDTEKFQDKE
NT seq 1683 nt NT seq  +upstreamnt  +downstreamnt
atgaacctcgcttcaagatatatcgggaaaaccgattttgattcttatgaagatttttgt
gcgaattatcaagtgaaagtacctgacaattttaattttgcgtatgatatcgtcgatgaa
tatggccgtctggaaccagagcgtccagcgctggtctggtgcgacgaccatggtaatgaa
cggatctttacctttgccgacctgaaaaaatactcggataaaacggcgaacatgttaagc
gaagccgggatccgcaaaggcgacaaagtcatgctgattctgagaaggcgttatgaagtg
tacatagcgattctggctctggccaaaatcggcgcgatctatattccttcttccaatcag
cttacgcagaaggatattatttatcgaaataatgccgcatcgattaaagcgatcattgcc
tatcatgatccggtaattctcgaccatgtcgaagcttccagggaagaatcgtcaacgctc
gaaacgctgtttctagttggggcccggcgtcccggctgggttgattttgacagcagcatg
gaggctgcttccgaaaactgggtccggccaacaggtgctgatgcgacaacgaatgacgac
acaatgatcatctatttcacgtcagggaccacgagcatgcccaaaatggccattcagagc
ttcacctatccgcttggtcatattgtgacggctaaatactggcagcgcgtcgtggacggc
gggcttcaccttacggtttccgattccggctgggctaaattcggctgggggaaaatttac
ggccagtggatttgcggcgcagtgcagtttgtctatgatatggacaagtttatccctgaa
aagcttttggaaatgatgcaaaaatataagctgtccacgttttgtgcaccgccgacaatt
tatcgcttcctgcttgaacacaatcttgaaaaatataacctgtcctcgattgttcactgc
tccacagccggagagcccttaaatccggatgtctttaaccgttttaaaagcattaccggc
ttaagcatcttaaacggatttggccagagcgagacgaccgtgctggttgccaattttgaa
tggctggatatttatccaggagcgatgggcaaaccgaatccagcctacaagattgatgtg
gtcgatgaaaacggagctccatgccctccgggagtcgaaggagaactggttatccgcgag
gctgattccaataagcctgccggattgttctgcgggtactacatggatgaaactgctacc
aataaagtgtggtatgacgatacgtaccacacaggggatatggcctactgggatgaacac
ggctttttatggtttgttggccgcaatgacgatgtcattaaggcttccggctacaggatc
agtccttttgaagttgaaagtgcactaattgagcatcccgcagtcgtggagtgtgctgtt
accggcgcgccggatgccgtcaggggaacggtcgtcaaagcgactgttgtgctggccaaa
ggctatacggcctctgaattgctaaaaaaagagatccaggactatgtcaaaaaggtgaca
gctccgtataaatacccgagaattctcgaatttgtcgacgaactgccgaagacgatcggc
ggcaagatcaaacgcgcccagatccggcgtgaagacacggaaaagtttcaagataaagaa
taa

DBGET integrated database retrieval system