KEGG   Dehalobacter sp. CF: DCF50_p777Help
Entry
DCF50_p777        CDS       T02279                                 

Definition
(GenBank) Tryptophan synthase beta chain like protein
  KO
K06001  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
dec  Dehalobacter sp. CF
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:dec00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    DCF50_p777
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    DCF50_p777
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    DCF50_p777
Enzymes [BR:dec01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     DCF50_p777
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
811107..812486
Genome map
AA seq 459 aa AA seqDB search
MKTMTSIPYKIYLPEEEMPKYWYNVKAVMKELPPPFIHPGTMKPCTADDLRPIFCDELIE
QELNNTDEYIEIPEEVREYYRMYRPSPLVRAYNLEKLLDTPAEIYFKFEGTNTSGSHKLN
SAAAQVYYAKKQGLSSLTTETGAGQWGTALSMACAFYNIPLTVYMVKVSAEQKPYRKAVI
ETYGGKVIPSPSDTTEIGRKILAENPGTGGSLGCAISEAIETSVKTENCRYVLGSVLDHV
LLHQSVIGEETKLACDKYGIEPEMIIGCIGGGSNFGGLVAPFMGDKIRGKNNIEFIGVEP
ASCPSLTRGKYAFDFGDTGKTTPLIKMYTLGSGFIPSPNHAGGLRYHGMSGIVSKLYNDG
YMTARAVEQSKVFEAATAFARCEGILPAPESAHALRVAMDEALKCKETGQKKTILFGLTG
TGYFDMAAYMSYNAGTMTDYIPTDADLEKGFATLPKVDL
NT seq 1380 nt NT seq  +upstreamnt  +downstreamnt
atgaagaccatgacaagcataccttacaaaatctatttacctgaagaagagatgcccaag
tactggtataatgtaaaagctgttatgaaagagctcccgccgccctttatccatccgggc
accatgaagccttgcaccgcagatgatctgcggccgatcttctgtgatgaactgattgaa
caggaactgaacaacacggacgaatatattgaaattcctgaggaagttcgcgaatactac
aggatgtaccgtccttccccgctcgtgagagcctataatcttgaaaagctgctggataca
cctgcagagatctattttaaatttgaaggcacgaatacttcaggttcccacaaattaaac
tctgcagctgcccaggtttattacgccaaaaaacaggggctttcttcactgacaacggaa
accggtgccggacaatggggtacggccttatcgatggcctgtgcgttttataatattcca
ttaacggtctatatggtgaaggtatctgcagaacagaagccttaccggaaagctgtcatt
gaaacctatggcggaaaagtcattccatctccttccgacacgacggaaattggccggaag
attttggctgaaaaccccggcacaggcggttctcttggctgtgcgatttcggaagcgatt
gaaacatctgtcaaaaccgaaaactgtcgttatgtacttggcagcgtactcgaccatgtc
ctgctgcaccagtccgtgatcggcgaagaaaccaagcttgcctgtgacaaatacggcatt
gagcctgaaatgattattggctgtatcggcggcgggtcgaactttggcggtctggttgca
cctttcatgggtgacaagatccgcggcaaaaacaatatcgagtttattggtgttgaacct
gcctcctgcccttctctgacccgcggcaaatatgcgtttgattttggggatacaggaaaa
acgacacccctgatcaaaatgtatacgctcggatcagggttcattccctctccgaatcac
gccggaggcctcaggtatcacggtatgagcggaatcgtttccaaactgtacaatgacggc
tatatgacagcccgggcagttgaacagtccaaggtatttgaagcagctacagcctttgcg
cgctgtgaaggcatcctgcctgctccagaatccgcacatgctttgcgggttgcaatggat
gaagcgctcaagtgtaaagaaaccggtcaaaagaagaccatcctgtttggcctgactggc
accggatattttgatatggctgcttatatgagctataatgccggcacaatgacagactat
attccgaccgatgctgatctggaaaaaggctttgcaacgctgccaaaagtggatctgtag

DBGET integrated database retrieval system