KEGG   Dehalobacter sp. CF: DCF50_p872Help
Entry
DCF50_p872        CDS       T02279                                 

Definition
(GenBank) 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
dec  Dehalobacter sp. CF
Pathway
dec00010  Glycolysis / Gluconeogenesis
dec00030  Pentose phosphate pathway
dec00051  Fructose and mannose metabolism
dec00052  Galactose metabolism
dec00680  Methane metabolism
dec01100  Metabolic pathways
dec01110  Biosynthesis of secondary metabolites
dec01120  Microbial metabolism in diverse environments
dec01130  Biosynthesis of antibiotics
dec01200  Carbon metabolism
dec01230  Biosynthesis of amino acids
dec03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:dec00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    DCF50_p872
   00030 Pentose phosphate pathway
    DCF50_p872
   00051 Fructose and mannose metabolism
    DCF50_p872
   00052 Galactose metabolism
    DCF50_p872
  Energy metabolism
   00680 Methane metabolism
    DCF50_p872
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    DCF50_p872
Enzymes [BR:dec01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     DCF50_p872
Protein phosphatases and associated proteins [BR:dec01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     DCF50_p872
Messenger RNA biogenesis [BR:dec03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     DCF50_p872
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK DAGK_cat NAD_kinase Peripla_BP_1
Motif
Other DBs
NCBI-ProteinID: AFV04879
UniProt: K4L365
Position
complement(919333..920301)
Genome map
AA seq 322 aa AA seqDB search
MGADSKVAVLTSGGDAPGMNTAIRAIVRKGIYHDLRVYGVFHGYDGLLRGEIKEMELGSV
ADIVHRGGTVLKTARCEEMFTAEGQRLAADQLKAKGIEALVVIGGDGSYRGAKKLAELGI
KVIGVPGTIDNDIAGTDSTIGFDTAVNTVVEAVSKLRDTASSHERTFLVEVMGRNCGDIA
LHSGLAIGAESILTPEIPFDLQEISEKLLRGYRRGKNHSIIICAEGAGDIREIASGLKKY
SGLENRVTILGHIQRGGAPSAADSLLGAMMGGKAIEALMEGKSEVMISHFQNEIVDRPLE
LAFKEKKMFNRKLYELANELAI
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgggcgcggatagcaaggttgcagttttaaccagcggaggggatgctcccggaatgaac
accgcgatacgggcgattgttcgtaagggcatttaccatgatctccgggtatatggggtt
ttccatggttatgatgggcttctgcgcggtgaaataaaagaaatggagctgggctcagtt
gcagatattgtgcatcgcggcggaacggttctgaaaactgccagatgtgaagaaatgttt
acggctgaaggccaacgtctggccgcggaccagctaaaggccaaaggaatcgaagcgctc
gtggtcattggcggagacggttcttaccgcggagcaaaaaaacttgctgaattgggtatc
aaagtcattggcgtgcccggtacgattgacaatgacattgctggaacagattcaacgatt
ggctttgacacggcggtgaacaccgttgtcgaggctgtaagcaaattaagagacaccgct
tcgtcccatgaacggacttttcttgtcgaagtcatgggcagaaactgcggggatattgcc
ctccactcaggactcgcgattggtgccgaatcgatcctgacgcccgaaatcccttttgat
cttcaggaaattagtgagaaactgctgcggggatatcggagaggaaaaaatcacagtatt
attatttgtgctgaaggagcaggggatatccgtgaaattgcttcaggcttaaagaaatat
tccggattggaaaaccgagtgacgattctcggccacattcaacgcggaggagcaccctcg
gcagccgattctttgctcggagcaatgatgggcggcaaggccattgaggcactgatggag
ggaaaatctgaggtgatgatctctcattttcaaaatgagattgtggacaggccattggaa
cttgcttttaaggaaaagaaaatgtttaaccgtaaactctatgagctggctaacgagctg
gctatttaa

DBGET integrated database retrieval system