KEGG   Dehalobacter sp. CF: DCF50_p872Help
Entry
DCF50_p872        CDS       T02279                                 

Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
dec  Dehalobacter sp. CF
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Class
Metabolism; Overview; Carbon metabolism [PATH:dec01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:dec01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:dec00010]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:dec00030]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:dec00051]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:dec00052]
Metabolism; Energy metabolism; Methane metabolism [PATH:dec00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(919333..920301)
Genome map
AA seq 322 aa AA seqDB search
MGADSKVAVLTSGGDAPGMNTAIRAIVRKGIYHDLRVYGVFHGYDGLLRGEIKEMELGSV
ADIVHRGGTVLKTARCEEMFTAEGQRLAADQLKAKGIEALVVIGGDGSYRGAKKLAELGI
KVIGVPGTIDNDIAGTDSTIGFDTAVNTVVEAVSKLRDTASSHERTFLVEVMGRNCGDIA
LHSGLAIGAESILTPEIPFDLQEISEKLLRGYRRGKNHSIIICAEGAGDIREIASGLKKY
SGLENRVTILGHIQRGGAPSAADSLLGAMMGGKAIEALMEGKSEVMISHFQNEIVDRPLE
LAFKEKKMFNRKLYELANELAI
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgggcgcggatagcaaggttgcagttttaaccagcggaggggatgctcccggaatgaac
accgcgatacgggcgattgttcgtaagggcatttaccatgatctccgggtatatggggtt
ttccatggttatgatgggcttctgcgcggtgaaataaaagaaatggagctgggctcagtt
gcagatattgtgcatcgcggcggaacggttctgaaaactgccagatgtgaagaaatgttt
acggctgaaggccaacgtctggccgcggaccagctaaaggccaaaggaatcgaagcgctc
gtggtcattggcggagacggttcttaccgcggagcaaaaaaacttgctgaattgggtatc
aaagtcattggcgtgcccggtacgattgacaatgacattgctggaacagattcaacgatt
ggctttgacacggcggtgaacaccgttgtcgaggctgtaagcaaattaagagacaccgct
tcgtcccatgaacggacttttcttgtcgaagtcatgggcagaaactgcggggatattgcc
ctccactcaggactcgcgattggtgccgaatcgatcctgacgcccgaaatcccttttgat
cttcaggaaattagtgagaaactgctgcggggatatcggagaggaaaaaatcacagtatt
attatttgtgctgaaggagcaggggatatccgtgaaattgcttcaggcttaaagaaatat
tccggattggaaaaccgagtgacgattctcggccacattcaacgcggaggagcaccctcg
gcagccgattctttgctcggagcaatgatgggcggcaaggccattgaggcactgatggag
ggaaaatctgaggtgatgatctctcattttcaaaatgagattgtggacaggccattggaa
cttgcttttaaggaaaagaaaatgtttaaccgtaaactctatgagctggctaacgagctg
gctatttaa

DBGET integrated database retrieval system