KEGG   Dehalobacter sp. DCA: DHBDCA_p1056Help
Entry
DHBDCA_p1056      CDS       T02278                                 

Definition
(GenBank) UTP--glucose-1-phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
ded  Dehalobacter sp. DCA
Pathway
ded00040  Pentose and glucuronate interconversions
ded00052  Galactose metabolism
ded00500  Starch and sucrose metabolism
ded00520  Amino sugar and nucleotide sugar metabolism
ded01100  Metabolic pathways
ded01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:ded00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    DHBDCA_p1056
   00052 Galactose metabolism
    DHBDCA_p1056
   00500 Starch and sucrose metabolism
    DHBDCA_p1056
   00520 Amino sugar and nucleotide sugar metabolism
    DHBDCA_p1056
Enzymes [BR:ded01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     DHBDCA_p1056
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 IspD CTP_transf_3
Motif
Other DBs
NCBI-ProteinID: AFV02083
Position
complement(1102644..1103564)
Genome map
AA seq 306 aa AA seqDB search
MKIKKAVIPAAGLGTRFLPATKALPKEMLPIVDKPTIQYIVEEAIDSGIEDILIITGRGK
WPIVDYFDHSPELEIYLESRGQLDLLEKIKNLSNMANIHYIRQNKPLGLGHAIYSAKSFV
GQEPFAVLLGDDVIKAKIPATQQLINVAERTSCSVIGIQEVLKSDVHKYGIVDPLDHIGD
VWRVKDLVEKPAVTEAPSRLAIMGRYVINPSIFKNLERIEPGAGGEIQLTDALKAQGKDE
PVYACRFEGKRYDVGDKIGYLKATVEFALESPDLGYQFGQYLEELYLERSKVKQREAKKR
GGIAAS
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atgaaaataaaaaaggccgtcattcctgcagcgggactcggtacaagatttctgccagcg
accaaagcactgccaaaagaaatgctgccgattgttgacaagccgacgattcagtatatt
gttgaagaagccattgactcaggaatagaagacattcttattattacaggaagaggcaag
tggccgatcgttgactactttgaccattcaccggagctggagatatatctggagagcaga
ggacagctagatcttctggaaaaaatcaagaatctttccaatatggctaacattcactat
atccgtcagaataaaccgcttggtcttgggcatgctatttattctgccaagtctttcgta
ggacaagagccctttgcagttttacttggcgatgatgttatcaaagctaagattccggca
acccagcaactaataaatgttgctgaaagaacttcctgcagtgtgattggaattcaggaa
gtgctcaaaagtgacgtgcataaatatggaatcgtagacccgcttgatcatattggcgat
gtttggagagtaaaggatcttgttgaaaaaccggctgttacagaagcaccttccagatta
gcgatcatgggccgatatgtgattaatccctcaatatttaaaaatttagagagaattgag
cctggagctggaggagaaatccaactaacagacgcactaaaagctcaaggcaaggatgaa
ccggtttacgcctgccgttttgaaggaaaaagatatgatgtaggtgataagattggttac
ttaaaagctacagtagaatttgcgttagaatctccagatcttggatatcaatttgggcag
tatcttgaggaattgtatcttgaaagaagtaaagttaagcaaagggaagctaagaagaga
ggcggtattgctgcttcctaa

DBGET integrated database retrieval system