KEGG   Dehalobacter sp. DCA: DHBDCA_p1056Help
Entry
DHBDCA_p1056      CDS       T02278                                 

Definition
UTP--glucose-1-phosphate uridylyltransferase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
ded  Dehalobacter sp. DCA
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ded00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    DHBDCA_p1056
   00052 Galactose metabolism
    DHBDCA_p1056
   00500 Starch and sucrose metabolism
    DHBDCA_p1056
   00520 Amino sugar and nucleotide sugar metabolism
    DHBDCA_p1056
Enzymes [BR:ded01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     DHBDCA_p1056
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1102644..1103564)
Genome map
AA seq 306 aa AA seqDB search
MKIKKAVIPAAGLGTRFLPATKALPKEMLPIVDKPTIQYIVEEAIDSGIEDILIITGRGK
WPIVDYFDHSPELEIYLESRGQLDLLEKIKNLSNMANIHYIRQNKPLGLGHAIYSAKSFV
GQEPFAVLLGDDVIKAKIPATQQLINVAERTSCSVIGIQEVLKSDVHKYGIVDPLDHIGD
VWRVKDLVEKPAVTEAPSRLAIMGRYVINPSIFKNLERIEPGAGGEIQLTDALKAQGKDE
PVYACRFEGKRYDVGDKIGYLKATVEFALESPDLGYQFGQYLEELYLERSKVKQREAKKR
GGIAAS
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atgaaaataaaaaaggccgtcattcctgcagcgggactcggtacaagatttctgccagcg
accaaagcactgccaaaagaaatgctgccgattgttgacaagccgacgattcagtatatt
gttgaagaagccattgactcaggaatagaagacattcttattattacaggaagaggcaag
tggccgatcgttgactactttgaccattcaccggagctggagatatatctggagagcaga
ggacagctagatcttctggaaaaaatcaagaatctttccaatatggctaacattcactat
atccgtcagaataaaccgcttggtcttgggcatgctatttattctgccaagtctttcgta
ggacaagagccctttgcagttttacttggcgatgatgttatcaaagctaagattccggca
acccagcaactaataaatgttgctgaaagaacttcctgcagtgtgattggaattcaggaa
gtgctcaaaagtgacgtgcataaatatggaatcgtagacccgcttgatcatattggcgat
gtttggagagtaaaggatcttgttgaaaaaccggctgttacagaagcaccttccagatta
gcgatcatgggccgatatgtgattaatccctcaatatttaaaaatttagagagaattgag
cctggagctggaggagaaatccaactaacagacgcactaaaagctcaaggcaaggatgaa
ccggtttacgcctgccgttttgaaggaaaaagatatgatgtaggtgataagattggttac
ttaaaagctacagtagaatttgcgttagaatctccagatcttggatatcaatttgggcag
tatcttgaggaattgtatcttgaaagaagtaaagttaagcaaagggaagctaagaagaga
ggcggtattgctgcttcctaa

DBGET integrated database retrieval system