KEGG   Dehalobacter sp. DCA: DHBDCA_p1082Help
Entry
DHBDCA_p1082      CDS       T02278                                 

Definition
Phosphomannomutase
Orthology
K15778  
phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
ded  Dehalobacter sp. DCA
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Purine metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:ded00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    DHBDCA_p1082
   00030 Pentose phosphate pathway
    DHBDCA_p1082
   00051 Fructose and mannose metabolism
    DHBDCA_p1082
   00052 Galactose metabolism
    DHBDCA_p1082
   00500 Starch and sucrose metabolism
    DHBDCA_p1082
   00520 Amino sugar and nucleotide sugar metabolism
    DHBDCA_p1082
  Nucleotide metabolism
   00230 Purine metabolism
    DHBDCA_p1082
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    DHBDCA_p1082
Enzymes [BR:ded01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     DHBDCA_p1082
    5.4.2.8  phosphomannomutase
     DHBDCA_p1082
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1129079..1130497)
Genome map
AA seq 472 aa AA seqDB search
MFKENFKNMFREYDIRGRVNSEELNKENVALITRAFSTFLLRRNINRVVVGYDNRSYSKE
FAEAAIQQFVADGFEVFDIGLTLSPVAYFAQYYLQSLGVMMITASHNPNGWSGFKLGDGY
SKTIGPEEIKEIFNILQTQDFSTLPQSGVRIIVEIRKAYIDAVVSRIHMSDYKPKVVLDA
GNGGAGLFAYEIFQRLGCLTFQLNCDPDTAYPHYFPNPSDLKARERLAQMVAHSHIQADL
GLAFDGDGDRLGVIDQYGNNIWSDRILIILARQLLEKKRGAKIVFDVKCTQGLTDDILAH
GGIPIMWKTGHSHIKSKMQSEKADLAGERSGHIFIADNYFGFDDAIFAGAKLIEYLSHVN
KSLTEVLEDVPSYITSPEIKAHCKDSEKYLVVDRLVESFKQEYGDKVIDINGARVVFNSG
WGLVRASSNLPELVLIFEADTQEKLLEIRSIFKEKITAFKEVAPNWENDLII
NT seq 1419 nt NT seq  +upstreamnt  +downstreamnt
atgtttaaagaaaattttaagaatatgttccgcgaatatgatatcaggggaagagtgaat
agtgaagaattaaataaagagaatgtcgcattgatcactagggcatttagtactttttta
ttgcggcgaaacattaatcgggttgtcgtaggctatgataaccgtagttattccaaagaa
tttgcagaggcagctattcaacagtttgttgcagacggttttgaggtatttgacataggc
ctgacattaagcccggttgcctactttgctcagtattacttacagagtcttggcgttatg
atgatcacagccagtcataatccgaatgggtggtcagggttcaagcttggggatggatat
tcaaaaacaattggccccgaggagatcaaagagatttttaacattcttcagactcaggac
ttcagcacgttacctcagtcaggggtccgtatcattgtggagattcggaaagcctatatt
gatgcagtcgtaagccgtattcatatgtccgattataagccaaaagttgttctggatgcc
ggaaatggcggggctggtttatttgcgtatgaaatttttcagaggcttggttgtcttact
ttccaactaaattgtgatcccgatactgcgtatccccattatttcccaaatccatctgac
ctcaaggcaagagaacgtttagcacaaatggttgcccactctcatattcaggcggatctt
gggctagcttttgatggtgacggggacagactgggggttattgatcagtatggaaataat
atttggagcgacagaatcttaatcattttggcaagacagcttttagaaaagaaaagaggt
gccaaaattgtttttgatgtaaagtgcacacaggggctaacagatgatattctggctcac
ggtggtattccgattatgtggaagaccggacattcccatataaaatcaaaaatgcaaagc
gaaaaggctgaccttgcgggtgaacgaagcggtcatatttttattgcagataattatttt
ggctttgatgacgccatatttgccggcgctaagcttatcgaatatttgtcccatgtcaat
aagtcactgactgaagtcctggaggatgttccttcttatatcacttctcctgaaattaaa
gcacattgtaaggactcggaaaaatatcttgttgtagatcggcttgtcgagagctttaag
caggaatacggggataaggttattgatatcaatggggcgcgagtggtatttaactcaggc
tggggattagtcagggcatcttcaaatttacccgaacttgtactgatttttgaagcggat
actcaagaaaaactattggaaattcgcagtatcttcaaagaaaaaataacagcttttaaa
gaagttgctcctaattgggaaaatgatttgattatttga

DBGET integrated database retrieval system