KEGG   Dehalobacter sp. DCA: DHBDCA_p1437Help
Entry
DHBDCA_p1437      CDS       T02278                                 

Definition
Guanylate kinase (EC:2.7.4.8)
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
ded  Dehalobacter sp. DCA
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:ded00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    DHBDCA_p1437
Enzymes [BR:ded01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     DHBDCA_p1437
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1450182..1450784)
Genome map
AA seq 200 aa AA seqDB search
MKIRLIKMEDKGLLIVVSGPAGVGKGTLCKRLFAECGDLEYSVSVTTRAPRPGETEGKEY
YFRSRDQFLKMVENNEFLEWAEFCGNLYGTPRFHVESVLKRNKTILLEIDMQGAKIVKKA
FPDGVFIFIVPPSLEELAERLYGRGTETPEVVQRRLAQAVQEMKNMKDYDYAVENDEIGT
AVEKLKSIMIAEKCRVSSKP
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atgaagatccggctgattaaaatggaagacaaaggactgctgattgtggtttcaggtcct
gcaggagttggaaaaggaacactgtgtaagcggctttttgccgagtgcggcgatctggaa
tattctgtttctgtaacgactagggcaccaagaccgggagaaacagagggaaaagaatac
tattttcgttccagggatcaatttcttaaaatggttgagaataatgagtttctggaatgg
gcagagttttgcggaaacctgtatggaaccccaagatttcatgtggaaagtgtcctgaag
agaaacaagaccatcttactggaaatcgatatgcagggagcaaaaattgtcaaaaaggct
tttccggatggtgtgtttattttcattgttccgccttccctggaagagctcgctgaaagg
ctttatggaagaggaacggaaacacctgaggtcgtgcagcgcagactggcacaagccgtt
caggaaatgaaaaatatgaaggattatgattatgctgttgagaacgacgaaattggcact
gcagtagaaaagcttaagagtattatgattgcagaaaaatgccgggtgagttcaaagcca
taa

DBGET integrated database retrieval system