KEGG   Dehalobacter sp. DCA: DHBDCA_p1911Help
Entry
DHBDCA_p1911      CDS       T02278                                 

Definition
Dihydrofolate reductase (EC:1.5.1.3)
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
ded  Dehalobacter sp. DCA
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ded00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    DHBDCA_p1911
   00670 One carbon pool by folate
    DHBDCA_p1911
Enzymes [BR:ded01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     DHBDCA_p1911
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1921824..1922312)
Genome map
AA seq 162 aa AA seqDB search
MKAIVSVDQNWGIGYKGDLLLKIPEDMKFFKQMTVGKVVVMGRGTYESLPGKEPLKDRTN
IVLSTNRDFQDERFIICHSLEDLLQELKEYPSDDICVIGGESLFQLLMPYLNELYVTKIR
HTFPADKHLRNVDEDDNWKVESEGELQTYNDIQYSVVKYVRK
NT seq 489 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcaatcgtttcggtagatcaaaactggggcattggctataaaggcgacctgctg
ctgaaaattccggaagatatgaagttttttaagcagatgactgttggcaaggtcgtggtc
atgggcagaggaacctatgaatcattgccgggaaaagagcccttgaaggacagaacgaat
attgtcctgagcacaaacagggattttcaggatgaaagatttattatctgtcattctctg
gaggacctgcttcaggagctgaaagaatacccttcggacgatatctgtgtgattggcgga
gaatcactttttcagctgctcatgccctatctgaatgaactgtatgtaacaaaaatcagg
cacacattccctgcggataagcatcttaggaatgtcgatgaagatgacaactggaaagtt
gagtctgaaggtgaattgcaaacttataatgacattcagtacagtgttgtaaaatatgta
agaaagtga

DBGET integrated database retrieval system