KEGG   Dehalobacter sp. DCA: DHBDCA_p1915Help
Entry
DHBDCA_p1915      CDS       T02278                                 

Definition
Glutamyl-tRNA synthetase, Glutamyl-tRNA(Gln) synthetase (EC:6.1.1.17 6.1.1.24)
Orthology
K09698  
nondiscriminating glutamyl-tRNA synthetase [EC:6.1.1.24]
Organism
ded  Dehalobacter sp. DCA
Pathway
Aminoacyl-tRNA biosynthesis
Metabolic pathways
Module
Aminoacyl-tRNA biosynthesis, prokaryotes
Class
Genetic Information Processing; Translation; Aminoacyl-tRNA biosynthesis [PATH:ded00970]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1925743..1927200)
Genome map
AA seq 485 aa AA seqDB search
MTVKVRFAPSPTGPLHIGGARSALFNYLFTGGKGGTFVFRIEDTDLERSSRESEQDIMNA
LHWLGITWDEGIDAGGDSGPYRQTERLDTYREYTDKLLQSGHAYLCYCSEEELEQERQEL
SARGETPRYLGKCRTLTAEQRQAYEAEGRKPVVRFRVPEGQDIVINDLVRGKVVFESNGI
GDYIIVKSDGIPTYNYAVVIDDVLMGITHVVRGEEHLSNTPRQVLIYEALGMKVPDFAHI
SLILNTEGRKMSKRDGDTAVMDYFHKGYLPEAVVNFIALLGWSPSGEQEFFTIEELKKEF
SLEKVSKSPAVFDLNKLNYINAHYLKQTASADLARLVLPFLREKGLFPNELSLAEQQWVT
GFIDAVKEKINCLSEVKSYIHYFIGTEIDVLTEEAEAIMKADTVPAVLQLFAAKVREAAL
LDAPAAKSILKEITKELNLKGKDVFMPVRIALTGQMHGPDLDRIMELLGKENIYGRLEKT
AAFSK
NT seq 1458 nt NT seq  +upstreamnt  +downstreamnt
atgacggtgaaagtaaggtttgctccaagcccgaccgggcccctgcatatcggaggagca
aggtcagctctttttaattatttgtttacaggaggcaaaggtgggacctttgtctttagg
atagaggataccgacctggaacggtcgagccgggaatcggaacaggatatcatgaacgcg
ctgcactggctggggatcacctgggacgaggggatagacgccggtggagattccggccct
tacaggcagacggaaaggctcgatacataccgtgaatacacggataagcttcttcagagc
ggacatgcttacctgtgctactgttcggaagaagaactggaacaggagcgtcaggagctg
agtgcccgtggggagaccccgcgctatctcggaaaatgccggacgctgaccgcagaacag
cgccaggcttatgaagcggaaggaaggaaacctgttgtccgcttccgagtgccggaaggc
caggatatcgtgatcaatgacctggtcagagggaaagtcgtttttgaaagtaatggaatc
ggggattatatcattgtcaaatcagatggaatcccaacatacaattatgccgtggtcatc
gacgatgtcctgatgggcatcacgcatgttgttagaggagaagaacatctatccaatacg
ccgcgtcaggtcttaatttatgaggcccttggaatgaaagtaccggattttgcccatatc
tccttgattttgaatactgaagggcggaagatgagcaaacgggacggggatactgctgtc
atggattatttccataaagggtatttgccggaggccgtcgtgaactttatcgcgctttta
ggctggtcgccttccggtgagcaggaattttttacgatcgaagaactcaagaaagaattt
tcattggaaaaagtatcaaagagcccggcagtttttgatttgaataaactgaactacatt
aatgcgcactacctgaaacagactgcttcggcagaccttgcccggttggtgctgccgttt
ttgagagaaaaaggactttttccgaatgagctttctttggccgaacagcagtgggtgacc
ggctttattgacgccgtaaaggaaaaaatcaactgcttaagcgaggttaagtcctatatt
cattattttattggaacagaaattgatgtgctgacggaggaagctgaagcgattatgaag
gcagataccgtaccggcagtgctgcagctttttgcagccaaggtccgggaagccgcgctg
ctcgacgcaccggcagccaagagcatattaaaagagatcaccaaagaacttaacctgaaa
ggcaaggatgtatttatgccggttaggattgcgcttacggggcagatgcatggcccggat
ctcgaccggatcatggaactgctcggcaaagaaaatatttacgggcgattggagaaaacg
gctgctttctcgaagtaa

DBGET integrated database retrieval system