KEGG   Dehalobacter sp. DCA: DHBDCA_p205Help
Entry
DHBDCA_p205       CDS       T02278                                 

Gene name
recR
Definition
Recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
ded  Dehalobacter sp. DCA
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:ded03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
205969..206565
Genome map
AA seq 198 aa AA seqDB search
MDYLYYPQPVSDLIAAFSRLPGVGPKTAGRLAFYLLRHPDQAGELTQAVTKALQDIKQCT
VCGNYTDIDPCKICSGERRDRTLLCVVEQPRDVIALEKTGEYKGLYHVLHGVLSPMEGIG
PEQLNLSPLFHRLEGVQEVVLAVNPTVEGEATSLYISKLLKPIEIKVTKIAHGLPVGGDL
EYADEVTIARALEGRRQL
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atggattatctatattatcctcagccagtgtccgatttgattgcggcattttctcgcttg
cctggagttgggccgaagactgcagggcgccttgccttttatcttttgaggcatccggat
caagccggtgaactgacgcaggcagtgacaaaagcgttgcaggatatcaaacaatgcacg
gtttgcgggaattataccgatattgatccatgtaaaatttgttcaggagaacgcagggac
agaacgcttctttgtgtcgtagaacagccccgcgatgtgattgcgctggagaagaccggc
gaatataaagggctttatcatgtcttacacggtgtactgtcgccaatggaagggatcggg
ccggagcagcttaatctatctccattattccaccggctggaaggggttcaggaagttgta
ctggcagtgaatccaacggttgaaggtgaggccacctcattgtatatttcaaagctccta
aaacccatcgagattaaagtaacaaagatcgcgcatggcctgccggtaggcggagattta
gaatacgcggatgaagtcaccattgcccgggcgctcgaaggcagacgtcagctgtaa

DBGET integrated database retrieval system