KEGG   Dehalobacter sp. DCA: DHBDCA_p2081Help
Entry
DHBDCA_p2081      CDS       T02278                                 

Definition
1-deoxy-D-xylulose 5-phosphate reductoisomerase (EC:1.1.1.267)
Orthology
K00099  
1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
ded  Dehalobacter sp. DCA
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ded00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    DHBDCA_p2081
Enzymes [BR:ded01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     DHBDCA_p2081
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2121217..2122365)
Genome map
AA seq 382 aa AA seqDB search
MKIISVLGSTGSIGTQTLDVVRNSEGKLAVYALSANSRADLFEQQIREFRPRIAVMMQEE
KALYLKQQVVDLPVKVLVGMEGLLEAATAAEVDTVVTAVSGSIGLEPTLAALNAGKNIAL
ANKETLVAAGELVMQTAERNGCSIIPVDSEHSAVFQCLSGNENAVKKIILTASGGPFRGW
SRERLAEVTPVMALKHPNWNMGAKITIDSATMMNKGLEVIEAKFLFGVDYDQIDVLVHPQ
SIVHSMVEFHDGTVLAQLGIPDMRIPIQYALTYPERWENRLPELSLAGKSLTFEKPDLAA
FPFLKFACSCGQTGGTLPAVMNAANEICVHAFLAGRIKYLEMHELVERTCQAHQVLEIKD
LDTVLTADRWAREYAASQINLG
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaataatctcggttttaggctccaccggttcaattggcacgcagacactggatgtg
gtcagaaattcggaaggaaaattagctgtctatgctttgtcggccaattctcgggccgac
ctttttgaacagcagatccgcgagttcaggccgaggattgccgtaatgatgcaggaagaa
aaagcactttacctgaaacaacaggttgttgacctgcctgttaaggtgctggtaggtatg
gagggactgcttgaggcggcgactgcagcagaggttgacacggttgtgaccgcagtcagc
ggcagtattggtcttgaacctacactggctgcactgaacgcaggaaaaaatattgcgctg
gccaacaaagaaacgctcgttgccgcaggggaactcgtaatgcagacagcagaacggaac
ggctgttccatcattcctgttgacagtgaacactctgctgtgttccagtgtctcagcggc
aacgaaaatgcagttaaaaaaattattttgactgcttcaggcggccctttcagaggatgg
agcagggaaaggctggctgaggtaacaccggtaatggcgctgaaacatccgaactggaat
atgggcgccaagatcaccattgattcagcaaccatgatgaacaaaggtttggaagttatt
gaggcaaaatttcttttcggcgtagattatgaccaaattgatgttttggttcatcctcag
agcattgttcactcgatggtcgaattccatgacggcactgttcttgcccagcttggcata
ccggatatgcgcattccaattcagtatgcgctgacctatcccgaacgctgggaaaaccgt
ttgccggaactttcgcttgccggaaagagcttaacgtttgagaagcccgatttggctgct
ttcccatttttgaaattcgcttgttcctgcggtcagacgggagggacacttcctgctgtc
atgaatgctgccaacgaaatctgtgtacatgctttcctggcaggacgcataaaatatctt
gagatgcacgaacttgtggaacgcacttgtcaggcccatcaggttctggagataaaggac
ctggataccgtactgactgcggacagatgggctagggagtatgctgcatcacaaataaat
ctgggttga

DBGET integrated database retrieval system