KEGG   Dehalobacter sp. DCA: DHBDCA_p2316Help
Entry
DHBDCA_p2316      CDS       T02278                                 

Definition
Chemotaxis response regulator protein-glutamate methylesterase CheB (EC:3.1.1.61)
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
ded  Dehalobacter sp. DCA
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:ded00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    DHBDCA_p2316
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    DHBDCA_p2316
Enzymes [BR:ded01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     DHBDCA_p2316
Two-component system [BR:ded02022]
 CheA family
  CheA-CheYBV
   DHBDCA_p2316
Bacterial motility proteins [BR:ded02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    DHBDCA_p2316
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2371083..2372102)
Genome map
AA seq 339 aa AA seqDB search
MAKKKIRVLIVDDSIVFREILARGIASDPEIEVVGMAADPFEARDKILEVEPDVMTCDVQ
MPKMNGIEFICKLLPQYPIPVIVISTVSDAVFDAMNAGAVEFVGKPDMKAAQRVETFLNE
LKIKIKVASVARIIPSMKDTTEKVESQHAENSEKIIAIGASTGGTEAVCNIMKRLPANMP
GIVIVQHIPPVFSRMFAERLNNQTKLKVKEARTGDYLEQGMALVAPGDQHVRIKKIANRY
RIECFAGEKVNGHCPSVDVLFESVAKEAGKNALGVILTGMGYDGAKGLLQMRRKGARTIG
QDQDSCVVYGMPKVAHDIGAVERQTSLMNIPQLICTMLK
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
atggccaaaaaaaagattagggttttaattgtagatgattccatcgttttccgggagatt
ctggccagaggaatcgccagtgacccggagatcgaagttgtgggtatggccgcagacccg
tttgaagccagggataaaatcctggaagttgaaccggacgtgatgacctgtgatgtccag
atgcccaaaatgaacgggattgaatttatctgcaagctgctgccgcaatatccgattccg
gtgattgtgatcagtacggtgagcgatgctgtttttgatgcgatgaatgccggggctgtc
gaatttgtcggcaagccggatatgaaggctgcgcagagagtggaaacctttttaaatgag
ttgaagattaagatcaaggtagcctccgtcgcccggattatcccgtcgatgaaggatacg
actgaaaaagttgaaagccagcatgccgagaattcggaaaaaatcattgcgatcggcgct
tccaccggcggaacggaagccgtctgcaatatcatgaagcgactgcctgcgaatatgccc
gggatcgttatcgtccagcatatccctcctgttttttcccggatgtttgccgagcggctg
aataatcagaccaaactgaaggtcaaggaagctcggaccggggattacctggaacaggga
atggccttagttgcgcctggagaccagcatgtcagaatcaaaaagatagccaatcgatac
aggattgagtgcttcgcaggagaaaaggtcaacggtcattgtccttccgtcgatgtctta
tttgaatctgtggccaaggaagcaggcaaaaatgcgctgggtgtcattttgaccggtatg
ggatatgacggggccaagggactcctgcagatgagaagaaaaggggccagaacgatcggt
caggatcaggattcctgtgtggtctacggcatgccgaaagttgctcatgatatcggggcc
gttgaaagacaaacttctttaatgaacatccctcagttgatttgtacgatgctgaagtaa

DBGET integrated database retrieval system