KEGG   Dehalobacter sp. DCA: DHBDCA_p243Help
Entry
DHBDCA_p243       CDS       T02278                                 

Definition
Glycerol kinase (EC:2.7.1.30)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
ded  Dehalobacter sp. DCA
Pathway
Glycerolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:ded00561]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
246976..248469
Genome map
AA seq 497 aa AA seqDB search
MVQKYIIALDQGTTSSRAVVFNHEGMIVGKAQKEFAQIYPFPGWVEHDPLEIWDTQLAAI
REVLDQTDINPDDIVGLGIANQRETTVVWNRFTGKPVYHAIVWQCRRTTELCEQILNSTL
NEYISDATGLVADAYFSGTKIRWILDHIPDGQVMAEEGDLLFGTIDSWLVWNLTKGRLHI
TDYSNASRTMLYNIRELAWDDKILSYLDIPRSLLPEVCPSSLCCGVTDSSIFGAEIPIAG
IAGDQQAALFGQACFTEGMVKNTYGTGCFILMNTGKNMIRSQNKLLTTIAWGIDNRVEYA
LEGSVFIGGAVIQWLRDELGLLKTSAESEYYATQVKDTNGVYIVPAFVGLGAPYWDMHAR
GIVTGLTRGANRFHLVRAALESIAYQTNDVLTAMAKDANIPLKALKVDGGAADNNFLLQF
QADLSGIPVERSEICEVTALGAAYLAGLAAGYWKDKEELKCLSKGRFISDSNITESERQQ
YLSGWKAAVSQATYRTV
NT seq 1494 nt NT seq  +upstreamnt  +downstreamnt
atggtccaaaaatatattattgcgctcgatcaggggacgacaagctcacgggctgtcgtt
tttaaccatgaaggaatgattgtaggcaaagcccaaaaagagtttgctcagatctatccg
ttcccggggtgggttgaacatgatcctttggaaatctgggacacccagctggctgctatc
agagaggttctggatcagacggacataaatccggatgatattgttgggctagggatagca
aatcaaagggagacgactgtggtttggaaccgttttaccggcaaacctgtctatcatgcg
attgtctggcaatgccgcagaacgacggaactttgcgagcagatactgaacagtacctta
aacgagtatatttcagatgcgaccggccttgttgcggatgcttatttttccggaacaaaa
atccgctggatcctcgatcatatcccggatggccaggtgatggccgaagaaggagatttg
ctttttggcacaattgacagctggctcgtctggaatcttaccaaaggccggctgcatatc
acggattacagcaatgcctcccgaaccatgctctataatatcagggaactagcgtgggat
gacaaaatattatcttatctggatatccccagatcactgctgccggaagtctgtccgagc
agcctctgctgcggggtaacagattcttcgatatttggcgctgaaataccgatagctgga
atagccggtgatcagcaggccgcactttttgggcaggcctgctttacagaaggaatggtc
aaaaatacctacggtacgggttgttttatcctaatgaataccggtaaaaatatgatccgg
tctcaaaataaattgctgacgacaattgcctgggggattgacaacagggtggaatatgcg
ctggaaggcagtgtatttattggcggagcagtcattcagtggcttcgtgatgaacttgga
ttgctgaaaacttctgccgaaagcgagtattatgcaactcaggtcaaagatacgaacggt
gtctatattgttccggccttcgtcggactcggcgcaccatactgggatatgcatgcccgc
ggcatagtgaccggacttacccggggagcaaaccgcttccaccttgtaagagccgcgctg
gagagcattgcttatcagacaaatgatgttcttacggcaatggctaaggatgccaatatc
cctcttaaggccttgaaagtagacggcggcgcagccgataataattttctgctgcagttt
caggcggatctcagcgggattccggttgaacggtcagaaatttgtgaggttacggctttg
ggagcagcatatctggcaggtttggcagccggatactggaaggacaaggaagagctaaaa
tgcctcagtaaagggcgttttatttctgattcgaacatcaccgaatctgagcgtcagcaa
tacctgagcggatggaaagcggcagtcagtcaggcaacctatcggacggtatga

DBGET integrated database retrieval system