KEGG   Dehalobacter sp. DCA: DHBDCA_p243Help
Entry
DHBDCA_p243       CDS       T02278                                 

Definition
Glycerol kinase (EC:2.7.1.30)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
ded  Dehalobacter sp. DCA
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ded00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    DHBDCA_p243
Enzymes [BR:ded01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     DHBDCA_p243
Exosome [BR:ded04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   DHBDCA_p243
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
246976..248469
Genome map
AA seq 497 aa AA seqDB search
MVQKYIIALDQGTTSSRAVVFNHEGMIVGKAQKEFAQIYPFPGWVEHDPLEIWDTQLAAI
REVLDQTDINPDDIVGLGIANQRETTVVWNRFTGKPVYHAIVWQCRRTTELCEQILNSTL
NEYISDATGLVADAYFSGTKIRWILDHIPDGQVMAEEGDLLFGTIDSWLVWNLTKGRLHI
TDYSNASRTMLYNIRELAWDDKILSYLDIPRSLLPEVCPSSLCCGVTDSSIFGAEIPIAG
IAGDQQAALFGQACFTEGMVKNTYGTGCFILMNTGKNMIRSQNKLLTTIAWGIDNRVEYA
LEGSVFIGGAVIQWLRDELGLLKTSAESEYYATQVKDTNGVYIVPAFVGLGAPYWDMHAR
GIVTGLTRGANRFHLVRAALESIAYQTNDVLTAMAKDANIPLKALKVDGGAADNNFLLQF
QADLSGIPVERSEICEVTALGAAYLAGLAAGYWKDKEELKCLSKGRFISDSNITESERQQ
YLSGWKAAVSQATYRTV
NT seq 1494 nt NT seq  +upstreamnt  +downstreamnt
atggtccaaaaatatattattgcgctcgatcaggggacgacaagctcacgggctgtcgtt
tttaaccatgaaggaatgattgtaggcaaagcccaaaaagagtttgctcagatctatccg
ttcccggggtgggttgaacatgatcctttggaaatctgggacacccagctggctgctatc
agagaggttctggatcagacggacataaatccggatgatattgttgggctagggatagca
aatcaaagggagacgactgtggtttggaaccgttttaccggcaaacctgtctatcatgcg
attgtctggcaatgccgcagaacgacggaactttgcgagcagatactgaacagtacctta
aacgagtatatttcagatgcgaccggccttgttgcggatgcttatttttccggaacaaaa
atccgctggatcctcgatcatatcccggatggccaggtgatggccgaagaaggagatttg
ctttttggcacaattgacagctggctcgtctggaatcttaccaaaggccggctgcatatc
acggattacagcaatgcctcccgaaccatgctctataatatcagggaactagcgtgggat
gacaaaatattatcttatctggatatccccagatcactgctgccggaagtctgtccgagc
agcctctgctgcggggtaacagattcttcgatatttggcgctgaaataccgatagctgga
atagccggtgatcagcaggccgcactttttgggcaggcctgctttacagaaggaatggtc
aaaaatacctacggtacgggttgttttatcctaatgaataccggtaaaaatatgatccgg
tctcaaaataaattgctgacgacaattgcctgggggattgacaacagggtggaatatgcg
ctggaaggcagtgtatttattggcggagcagtcattcagtggcttcgtgatgaacttgga
ttgctgaaaacttctgccgaaagcgagtattatgcaactcaggtcaaagatacgaacggt
gtctatattgttccggccttcgtcggactcggcgcaccatactgggatatgcatgcccgc
ggcatagtgaccggacttacccggggagcaaaccgcttccaccttgtaagagccgcgctg
gagagcattgcttatcagacaaatgatgttcttacggcaatggctaaggatgccaatatc
cctcttaaggccttgaaagtagacggcggcgcagccgataataattttctgctgcagttt
caggcggatctcagcgggattccggttgaacggtcagaaatttgtgaggttacggctttg
ggagcagcatatctggcaggtttggcagccggatactggaaggacaaggaagagctaaaa
tgcctcagtaaagggcgttttatttctgattcgaacatcaccgaatctgagcgtcagcaa
tacctgagcggatggaaagcggcagtcagtcaggcaacctatcggacggtatga

DBGET integrated database retrieval system