KEGG   Dehalobacter sp. DCA: DHBDCA_p2696Help
Entry
DHBDCA_p2696      CDS       T02278                                 

Definition
UTP--glucose-1-phosphate uridylyltransferase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
ded  Dehalobacter sp. DCA
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ded00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    DHBDCA_p2696
   00052 Galactose metabolism
    DHBDCA_p2696
   00500 Starch and sucrose metabolism
    DHBDCA_p2696
   00520 Amino sugar and nucleotide sugar metabolism
    DHBDCA_p2696
Enzymes [BR:ded01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     DHBDCA_p2696
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2761765..2762721)
Genome map
AA seq 318 aa AA seqDB search
MQKIRKAVIPAAGLGTRFLPATKAQPKEMLPIVDKPTIQYIIEEAVQSGIEDVIIVTGRN
KRAIEDHFDRSVELELFLKNGEKSELLDMVKHIAEMVDIHYVRQKEALGLGHAVYSARRF
IGNEPFAVLLGDDVIYSDEPCLKQMIRYYELYNSNLIGVQEVLPAEVSKYGIIDGSRISP
RLYKAEAMFEKPAPEEAPDIPLAIMGRYILNPEIFDILAELPPGRNGEIQLTDAIAQLSK
VQDVYAYNFEGKRYDVGDKLGFVRATIEFALRHEEIGESLMDYLTDIVSRYQKEGQELRL
LSAGNNLDKLYDIKKNYS
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
ttgcagaaaattcgtaaagcagtcatacccgcggctggattgggtacaagatttcttcct
gcgaccaaagctcaacccaaagaaatgctgccaatcgtagacaaaccgaccattcagtac
atcattgaagaagcggttcaatccggtattgaagatgtcattattgtcacaggaagaaac
aaaagagccattgaggatcattttgaccgttctgtagaacttgaactatttctaaaaaac
ggagaaaagtccgaattgctcgatatggtcaaacatattgctgagatggtcgatatccat
tatgtccgccaaaaagaagctctggggcttggtcatgccgtatacagtgccagaagattt
attggcaatgagccgtttgccgttcttttgggagacgatgtgatctattcggatgagcct
tgtctgaaacaaatgattaggtactacgagctgtataacagcaatctgattggcgtacag
gaagtactgccggcagaagtgtccaaatacgggattattgatggcagcagaatatctccg
agactgtacaaggcggaagccatgtttgaaaagccggccccggaggaagcgcctgatatt
ccgcttgcgatcatgggccggtatattcttaatccggaaatttttgatatcctcgcggaa
ttgcctccgggaagaaatggagaaattcagctaacggatgcaattgcgcagttgagcaag
gttcaggatgtgtatgcctacaattttgaagggaaaagatatgatgtcggggacaaactt
ggttttgtcagagcaaccattgaatttgcgttaagacatgaagaaattggcgaaagcctg
atggattatctgaccgatatcgtcagccggtatcagaaagaaggtcaggagcttcgcctg
ctttcagcaggcaataatttggacaaactttatgatattaagaagaattacagttaa

DBGET integrated database retrieval system