KEGG   Dehalobacter sp. DCA: DHBDCA_p2817Help
Entry
DHBDCA_p2817      CDS       T02278                                 

Definition
(GenBank) carboxylesterase (est)
  KO
K03928  carboxylesterase [EC:3.1.1.1]
Organism
ded  Dehalobacter sp. DCA
Brite
Enzymes [BR:ded01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.1  carboxylesterase
     DHBDCA_p2817
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Hydrolase_4 Abhydrolase_6 Abhydrolase_1 Peptidase_S9 DLH PGAP1 Thioesterase BAAT_C DUF1057 FSH1 Ser_hydrolase DUF915 Esterase Chlorophyllase2 Abhydrolase_5 DUF676
Motif
Other DBs
NCBI-ProteinID: AFV03844
Position
complement(2897800..2898564)
Genome map
AA seq 254 aa AA seqDB search
MFTREELIKPFYFSGGSTAILLIHGFTACPIDMKPLGERLKNWGYTVQAPLLPGHGTSIE
DLKKTSWQDWERAVAEAAEQLKKTCQRVLAIGHSMGGLLALSLAAQGRIDGAVSINAPII
YVDEKLHQAESLIGKIEYVGKPHKTAEISLNSEGLPHFSYIQVPVISFISLNQAIERMKG
KLPQISCPTLMVQSMADGTVHPSSGEFIQKSIGDRYCDAVYWKDEDHYLPLSAARDELAQ
KIREFIEKRQLLVP
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atgtttacacgagaagagctgatcaaacctttttacttttcaggcggaagcacggcgatc
cttctgattcacggctttacagcctgcccgattgatatgaagccacttggcgagagattg
aaaaattggggatatacagtccaggccccgcttctgcccggccatggaacttcaatagaa
gacttgaagaagacatcctggcaggattgggagcgagctgttgccgaagcagctgagcaa
ttaaagaaaacgtgtcagagagtccttgccattggacattccatgggcggattgctggca
ctatctctggcagctcagggcaggatcgacggtgcagtctccatcaatgccccgattatt
tatgttgatgaaaagctgcatcaggccgaaagcttgataggaaaaatagaatatgttggc
aagccgcataaaaccgctgagatcagcctgaacagcgagggactcccacatttttcctat
attcaggtaccggtaatatcatttatttccttaaaccaagccattgaacgaatgaaagga
aagttgccccaaattagctgtccgacgcttatggtccagagcatggctgacgggacagtc
catccgtccagcggcgaatttattcagaagagcatcggagaccgttattgcgatgcagtt
tactggaaagatgaggaccactatctgccgttgagcgcagcgcgggacgaattggcccaa
aaaatacgggaatttatagaaaagcgtcagctgctggtcccatag

DBGET integrated database retrieval system