KEGG   Dehalobacter sp. DCA: DHBDCA_p2817Help
Entry
DHBDCA_p2817      CDS       T02278                                 

Definition
carboxylesterase (est)
Orthology
K03928  
carboxylesterase [EC:3.1.1.1]
Organism
ded  Dehalobacter sp. DCA
Brite
Enzymes [BR:ded01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.1  carboxylesterase
     DHBDCA_p2817
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2897800..2898564)
Genome map
AA seq 254 aa AA seqDB search
MFTREELIKPFYFSGGSTAILLIHGFTACPIDMKPLGERLKNWGYTVQAPLLPGHGTSIE
DLKKTSWQDWERAVAEAAEQLKKTCQRVLAIGHSMGGLLALSLAAQGRIDGAVSINAPII
YVDEKLHQAESLIGKIEYVGKPHKTAEISLNSEGLPHFSYIQVPVISFISLNQAIERMKG
KLPQISCPTLMVQSMADGTVHPSSGEFIQKSIGDRYCDAVYWKDEDHYLPLSAARDELAQ
KIREFIEKRQLLVP
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atgtttacacgagaagagctgatcaaacctttttacttttcaggcggaagcacggcgatc
cttctgattcacggctttacagcctgcccgattgatatgaagccacttggcgagagattg
aaaaattggggatatacagtccaggccccgcttctgcccggccatggaacttcaatagaa
gacttgaagaagacatcctggcaggattgggagcgagctgttgccgaagcagctgagcaa
ttaaagaaaacgtgtcagagagtccttgccattggacattccatgggcggattgctggca
ctatctctggcagctcagggcaggatcgacggtgcagtctccatcaatgccccgattatt
tatgttgatgaaaagctgcatcaggccgaaagcttgataggaaaaatagaatatgttggc
aagccgcataaaaccgctgagatcagcctgaacagcgagggactcccacatttttcctat
attcaggtaccggtaatatcatttatttccttaaaccaagccattgaacgaatgaaagga
aagttgccccaaattagctgtccgacgcttatggtccagagcatggctgacgggacagtc
catccgtccagcggcgaatttattcagaagagcatcggagaccgttattgcgatgcagtt
tactggaaagatgaggaccactatctgccgttgagcgcagcgcgggacgaattggcccaa
aaaatacgggaatttatagaaaagcgtcagctgctggtcccatag

DBGET integrated database retrieval system