KEGG   Dehalobacter sp. DCA: DHBDCA_p2822Help
Entry
DHBDCA_p2822      CDS       T02278                                 

Gene name
tpiA
Definition
Triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
ded  Dehalobacter sp. DCA
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:ded00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    DHBDCA_p2822 (tpiA)
   01230 Biosynthesis of amino acids
    DHBDCA_p2822 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    DHBDCA_p2822 (tpiA)
   00051 Fructose and mannose metabolism
    DHBDCA_p2822 (tpiA)
   00562 Inositol phosphate metabolism
    DHBDCA_p2822 (tpiA)
Enzymes [BR:ded01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     DHBDCA_p2822 (tpiA)
Exosome [BR:ded04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   DHBDCA_p2822 (tpiA)
  Exosomal proteins of bladder cancer cells
   DHBDCA_p2822 (tpiA)
  Exosomal proteins of melanoma cells
   DHBDCA_p2822 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2904326..2905090)
Genome map
AA seq 254 aa AA seqDB search
MTRKPIIAGNWKMYKTVQEAKDFAAGLLENLEKLENGTNAEMVICAPFTALAALKDELEE
SIIHIGAQNMYYETQGAYTGEISPLMLTELACTYVIIGHSERREYFKEDDALIARKVKTA
LDFGLTPILCVGENLALREAGQALVFVQGQVENALRELSPEAIRKIVVAYEPIWAIGTGR
TASPQDAQEMCAAIRTTLARLSAEAAQEIRILYGGSVKASNIAELMDQPDIDGALVGGAS
LDFLGFTELIGSVR
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atgacaagaaagccgatcattgcaggtaattggaagatgtataagacggtacaggaagcc
aaagattttgccgcgggactgttggaaaatttggagaaactggaaaatggaacaaacgcg
gaaatggtaatttgtgcaccgtttactgcgctggctgccttaaaggatgaacttgaagag
agtatcatccatattggcgcccaaaatatgtattatgagacacaaggcgcgtataccgga
gagatatcgccgcttatgctgacagagctagcctgtacctatgtgattatcggccactcg
gaacgcagggaatattttaaagaagatgacgcgcttatagcaagaaaagttaagaccgca
ctggactttggactgacgccaattctgtgtgtcggtgagaacttggctttgagagaagca
ggtcaggccctagtctttgtgcaagggcaggttgagaatgccctcagggagttgagtcct
gaagcaatcagaaagattgttgttgcatatgaacccatttgggctatcggaacaggcagg
acagcctctccgcaggatgcccaggaaatgtgtgccgcaatccgtaccaccctggcgagg
ctctccgctgaagccgctcaggaaatacgaattttatacggtggaagtgtcaaggcttcc
aatatcgccgaactgatggatcagccggatattgatggtgcgctggtcggtggagcaagt
ctggacttccttggatttactgaactgattggcagcgtgaggtga

DBGET integrated database retrieval system