KEGG   Dehalobacter sp. DCA: DHBDCA_p283Help
Entry
DHBDCA_p283       CDS       T02278                                 

Definition
Dihydropteroate synthase (EC:2.5.1.15)
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
ded  Dehalobacter sp. DCA
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:ded00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
288836..290059
Genome map
AA seq 407 aa AA seqDB search
MKDLKAYNMRWLKIDSLLQAEKALSQVGVDLGVLQHMNGKALTKPIKLENVPAPVALILK
QEMLSFGGDAAVHKDLLDSGAPESDVLLLGNYKQLTRLADKLSSMSPECQYLAESLHEML
VYLDIPPAGVIDCRGKILEWGKKTLIMGILNVTPDSFSDGGKFDNIENALKQAEKMVADG
ADMLDIGGESTRPGYGGVSAEEEWSRLEPVLKALIPVCSVPISIDTQKAAVAAKSLRLGA
HIINDIWGLQKDPEMARVIAEYQAPIVIMHNQDHTEYKNMMGEILSFLERSIEMALDCGL
TQNQIIVDPGIGFGKTPEQNMEVLSRMEEFKSLGCPLLLGVSRKSVIGRTLNLPVDQRLE
PTIALGTLGIVAGADILRVHDVPENKKAALITDLVIRRKRGEDYEGK
NT seq 1224 nt NT seq  +upstreamnt  +downstreamnt
gtgaaggatttgaaggcgtacaatatgcgatggctcaaaatagatagcctactgcaggcc
gaaaaagctctcagccaggttggcgttgaccttggcgtccttcaacatatgaatggcaag
gctttgaccaaaccgatcaagctggagaatgtgccagctccggtggcattgattctgaaa
caggaaatgctctccttcggtggggatgcagctgtccataaagatttgctcgacagtgga
gcaccggaaagcgatgtattacttcttggtaactataagcagttaaccagactagcggat
aaacttagctcaatgtcgccagagtgccagtatcttgccgagtccctccatgaaatgttg
gtctatttagatatacctccggccggcgtgatcgattgcaggggaaaaattcttgagtgg
ggaaaaaagaccctgatcatgggaatcctgaatgttacaccggattctttttccgacggc
ggaaaatttgataacatcgagaatgctttaaaacaggccgaaaaaatggttgccgacggt
gctgatatgcttgatattggcggagagtccacccgcccgggatatgggggcgtcagtgcc
gaagaagagtggtccagacttgaaccggtacttaaagcacttatcccggtctgttcggtt
ccaatatcgattgatacccaaaaagcagctgttgcagccaagtctttgcggttgggggcc
catatcattaatgatatctggggtttgcagaaagatcctgaaatggcccgcgttattgca
gaatatcaagctccgatcgtgataatgcataatcaggatcatacagaatataagaatatg
atgggtgaaatattgtcattcctggagcgtagcattgaaatggctctagattgcggattg
acgcagaatcaaattattgtcgatcccggaatcgggtttggaaaaacaccggaacagaat
atggaagtcttaagccggatggaagaatttaaatcgctagggtgtcctcttcttctggga
gtatcccgcaaatccgtgattggacggaccttgaaccttccggttgatcaaaggctcgaa
ccgacgattgccctggggacgctcggaattgttgccggagcagatattctgcgtgtgcat
gatgttcccgaaaacaaaaaggctgcgcttatcactgacctggtgatacgtcgaaaaaga
ggagaagattatgaaggaaagtga

DBGET integrated database retrieval system