KEGG   Dehalobacter sp. DCA: DHBDCA_p525Help
Entry
DHBDCA_p525       CDS       T02278                                 

Definition
(GenBank) Tryptophan synthase beta chain
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
ded  Dehalobacter sp. DCA
Pathway
ded00260  Glycine, serine and threonine metabolism
ded00400  Phenylalanine, tyrosine and tryptophan biosynthesis
ded01100  Metabolic pathways
ded01110  Biosynthesis of secondary metabolites
ded01130  Biosynthesis of antibiotics
ded01230  Biosynthesis of amino acids
Module
ded_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:ded00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    DHBDCA_p525
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    DHBDCA_p525
Enzymes [BR:ded01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     DHBDCA_p525
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: AFV01553
Position
523082..524335
Genome map
AA seq 417 aa AA seqDB search
MKNEMVNYLGENGYFGAYGGRFVPEILIPAVDELSLAFQEILRDEDFYKQYYNLLMDFSG
RPTPLTYAEGLSAYFGKAKIFIKREDLNHSGAHKINNVLGQGLLMKKLGKTRVIAETGAG
QHGVATAIMAAKMGFQATIYMGAEDAERQYANVFWMKQLGAEVIPVTTGTATLKDAINEA
LRDWAGNFDNTHYALGTACGPRPFPEMVTFFQSVISKEMKKQINDICGKNPDRIYACLGG
GSNAMGAFVEFLQEPGVELVAVEAGGKGEASGKHASRIAYAKAKTGVSQGYKTLFLQDDD
GQMLDTWSISAGLDYVGVSPILAHLAETKRVRVLAATDAEVIEAFKLIISKEGLIPALES
THAFAGLFREIADTKPEDVIVVNMSGRGDKDIFNIGEALQDQGWKTFVTERGKAYAD
NT seq 1254 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaacgaaatggttaactatcttggggaaaatggttattttggcgcctatggcggg
agatttgtcccggaaatcctgataccggctgtcgatgaactgagtctggcttttcaggaa
atattgcgggacgaggacttctataagcaatactataacctcctgatggacttttcgggc
aggccgacaccgctgacgtatgcggaagggcttagtgcctattttggtaaagccaaaatc
tttatcaagcgggaggatttgaatcattccggcgcccataaaatcaataatgtgctcggg
cagggcctgctcatgaaaaaactgggcaagaccagagtcatcgctgagaccggcgcaggc
cagcacggtgtggcaacggcgatcatggcggcgaaaatgggatttcaggcgacgatctat
atgggggctgaagacgctgaacggcaatatgccaatgtcttctggatgaaacagctcgga
gctgaagttattcctgtgacaaccgggacggcaacgcttaaggatgccattaacgaagcg
cttcgcgactgggcaggaaattttgataacacgcattatgcacttggcacggcgtgcgga
ccgaggccattcccggagatggtcactttctttcagtccgtaatcagtaaagagatgaaa
aaacaaatcaacgatatctgcggcaaaaatccagaccggatctatgcctgtctgggcggc
ggttccaatgcgatgggcgcttttgtggaattcctgcaggagcccggcgtagaacttgtt
gccgtcgaggcaggcggaaagggcgaagcttccggaaaacatgcttcgcggatcgcttat
gccaaagccaaaaccggcgtctctcagggctacaagacattgtttctccaggatgatgac
ggacagatgctggatacctggagcatttccgccggacttgattatgtaggcgtatcacca
atcctggctcatttggcggaaaccaagagggtccgggttttagccgccacagatgccgaa
gtcattgaggcctttaaactgatcatcagcaaggaagggctgataccggcgcttgaatcc
acgcatgctttcgccggacttttcagggaaattgctgacaccaaaccggaagatgtcatc
gttgtcaatatgtccggccgcggagacaaagatatcttcaacattggggaagcattgcag
gatcagggctggaaaacatttgtcacagaaagaggtaaggcatatgcagattga

DBGET integrated database retrieval system