KEGG   Dehalobacter sp. DCA: DHBDCA_p526Help
Entry
DHBDCA_p526       CDS       T02278                                 

Definition
(GenBank) Tryptophan synthase alpha chain (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
ded  Dehalobacter sp. DCA
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:ded00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    DHBDCA_p526
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    DHBDCA_p526
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    DHBDCA_p526
Enzymes [BR:ded01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     DHBDCA_p526
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
524325..525107
Genome map
AA seq 260 aa AA seqDB search
MQIEKQIEAMRKEKKILLMTHQIIGYPDFAANEKVIECFYNNGVDLIELQIPFSDPIADG
PVFTKSNQAVLEKGIKVSNCLKFIERMASKYPIPFLVMTYYNILYQYGVEAFIDRCKEIG
VQGTIVPDAPLDEARAYYDYSRQQGLAAVSIATPYSDPKRLQEIADIGSGFIYYVPRKGV
TGSKTTFDSEILDGIQKAKKETGKTIAVGFGIQGPEDVARLIGTADIAIIGSKIQQVLET
EGLSGLDQFLGDMARVNKEE
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atgcagattgaaaaacaaattgaagctatgagaaaagagaagaaaatactgctgatgacc
caccaaattattggctatcctgattttgccgccaatgaaaaagtgattgaatgcttttat
aacaacggggtcgacctgattgaactgcaaatacctttttctgatccgattgctgacgga
ccggtattcaccaagtccaaccaggccgtattggaaaaagggattaaagtcagcaactgc
ctgaagtttattgagagaatggccagcaaatacccgatcccgtttttggtcatgacctac
tacaatattctgtaccaatacggcgtcgaagcatttattgaccggtgcaaagagattggc
gtccagggaaccatcgtgccggatgctccgcttgatgaggccagagcctactacgattat
tcccgccaacagggattggctgcagtaagtatagcgacaccttattccgatccgaagcga
ctgcaggaaattgcagatatcgggagcggattcatctattacgttccccgcaaaggggta
accggcagcaaaacaacttttgactctgaaattttggacggaatccaaaaagcaaagaaa
gagaccggcaaaacaatcgccgtaggtttcgggattcaaggcccggaagatgtcgcccgt
ttaattggaactgccgatatagcgatcatcggcagtaagatccagcaggtgcttgagact
gaagggctgtccggtctggatcagtttttaggcgatatggcgcgtgttaataaggaggaa
tga

DBGET integrated database retrieval system