KEGG   Dehalobacter sp. DCA: DHBDCA_p526Help
Entry
DHBDCA_p526       CDS       T02278                                 

Definition
Tryptophan synthase alpha chain (EC:4.2.1.20)
Orthology
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
ded  Dehalobacter sp. DCA
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:ded01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:ded00260]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:ded00400]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
524325..525107
Genome map
AA seq 260 aa AA seqDB search
MQIEKQIEAMRKEKKILLMTHQIIGYPDFAANEKVIECFYNNGVDLIELQIPFSDPIADG
PVFTKSNQAVLEKGIKVSNCLKFIERMASKYPIPFLVMTYYNILYQYGVEAFIDRCKEIG
VQGTIVPDAPLDEARAYYDYSRQQGLAAVSIATPYSDPKRLQEIADIGSGFIYYVPRKGV
TGSKTTFDSEILDGIQKAKKETGKTIAVGFGIQGPEDVARLIGTADIAIIGSKIQQVLET
EGLSGLDQFLGDMARVNKEE
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atgcagattgaaaaacaaattgaagctatgagaaaagagaagaaaatactgctgatgacc
caccaaattattggctatcctgattttgccgccaatgaaaaagtgattgaatgcttttat
aacaacggggtcgacctgattgaactgcaaatacctttttctgatccgattgctgacgga
ccggtattcaccaagtccaaccaggccgtattggaaaaagggattaaagtcagcaactgc
ctgaagtttattgagagaatggccagcaaatacccgatcccgtttttggtcatgacctac
tacaatattctgtaccaatacggcgtcgaagcatttattgaccggtgcaaagagattggc
gtccagggaaccatcgtgccggatgctccgcttgatgaggccagagcctactacgattat
tcccgccaacagggattggctgcagtaagtatagcgacaccttattccgatccgaagcga
ctgcaggaaattgcagatatcgggagcggattcatctattacgttccccgcaaaggggta
accggcagcaaaacaacttttgactctgaaattttggacggaatccaaaaagcaaagaaa
gagaccggcaaaacaatcgccgtaggtttcgggattcaaggcccggaagatgtcgcccgt
ttaattggaactgccgatatagcgatcatcggcagtaagatccagcaggtgcttgagact
gaagggctgtccggtctggatcagtttttaggcgatatggcgcgtgttaataaggaggaa
tga

DBGET integrated database retrieval system