KEGG   Dehalobacter sp. DCA: DHBDCA_p528Help
Entry
DHBDCA_p528       CDS       T02278                                 

Definition
(GenBank) Indole-3-glycerol phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
ded  Dehalobacter sp. DCA
Pathway
ded00400  Phenylalanine, tyrosine and tryptophan biosynthesis
ded01100  Metabolic pathways
ded01110  Biosynthesis of secondary metabolites
ded01130  Biosynthesis of antibiotics
ded01230  Biosynthesis of amino acids
Module
ded_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:ded00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    DHBDCA_p528
Enzymes [BR:ded01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     DHBDCA_p528
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS FMN_dh QRPTase_C
Motif
Other DBs
NCBI-ProteinID: AFV01556
Position
526235..527086
Genome map
AA seq 283 aa AA seqDB search
MILDKIVEAKIKRLSDQKKKISGEELIEKLTKKLKINDDRDNLKHDVNMERPAGVFASAL
TAGRLSKEKAGISIIAEVKKASPSKGILAPDFDYLQIASMYEQLGAAAISVLTEQDYFLG
SPDYLREIRESVKIPLLRKDFMIDPYQIYEAKILGADAILLIVKILDDQQLKEYLGIAEQ
IGLDCLVEVHNEAEAERAMAAGAGIIGINNRNLETFEVDLNHSRRIGAMVPDHLIKVSES
GIHTGEDILTAQAWGFDAVLVGEAFMKAGSLEQKFAELLFGIF
NT seq 852 nt NT seq  +upstreamnt  +downstreamnt
atgatccttgataaaattgtagaggccaaaataaaacggctttccgatcagaagaaaaaa
atttccggcgaagagctcatcgaaaagctaacaaaaaaactaaaaatcaatgatgatcgt
gataatcttaagcatgatgttaacatggagcggcctgcaggcgtctttgcctcagccctg
actgcgggacgcctgagcaaagaaaaagcagggatttccataatcgcggaagtcaagaaa
gcttctccatccaaaggaatcctggctccggacttcgattatctgcaaatagccagcatg
tatgaacagctgggggctgcggcaatctccgtcttaacagagcaggattactttctcggg
agtccggattatctgagggaaattagagaatccgtcaagattccgctgctgcgaaaggat
tttatgattgacccttatcagatttacgaagcaaagattttgggggcggatgctattctg
ctcatcgtaaaaatattagatgatcagcagctgaaagaatatcttggaatagctgaacag
atcggcctggattgtcttgtggaagtgcataacgaagcagaagctgaaagggccatggca
gcaggagccggcatcatcggaatcaataaccggaacctggagacgtttgaggtggatttg
aaccacagccgcagaatcggcgcgatggtcccggatcatctgatcaaggtctcagaaagc
gggattcatacgggcgaggatatcctaacggcgcaagcgtggggatttgatgctgttctg
gtcggagaggcttttatgaaggcaggcagtcttgaacaaaaatttgctgagctcctcttc
gggatattctga

DBGET integrated database retrieval system