KEGG   Dehalobacter sp. DCA: DHBDCA_p588Help
Entry
DHBDCA_p588       CDS       T02278                                 

Definition
(GenBank) Cellulase M-related protein (EC:3.4.11.-)
Organism
ded  Dehalobacter sp. DCA
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
588444..589496
Genome map
AA seq 350 aa AA seqDB search
MLRNSFELARELTCSLTEMTGVSGYEQGLKTTLQDIFVPLSTETFSDFIGNFYAVKKGEH
SGKHSVMLAAHIDEIGLMITHIDERGFLHFVTLGGIDQRTLLYQEILVHGKEELRGVVCL
GSSHKDSKKQQTLDIEDLVIDIGFNDAAAVQMVKPGDIASIKRCPLHLLNDRISGKALDD
RAGVAVLAVCLNELMGMKHQHDVVAVATVQEEVGLRGGLTSSERLLPSLAVAVDVTHAQT
LDTKSQVSAELAKGPVISLGPNIHPWVYARLSDSAQQNRIACQRQAVPGATGTDARVIQL
TGYGIPTGLVSIPLRYMHTSVETASLQDIVECGKLLAYFIASLPEELEEL
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
gtgttaaggaactccttcgagcttgcgcgggaacttacctgttcgttaacggaaatgaca
ggtgtttccgggtatgaacagggcttaaaaacaacacttcaggatatttttgtgccacta
tcgacagagactttctctgattttatcggcaatttctatgcggttaaaaaaggagaacac
agcgggaaacattccgtaatgcttgctgcccatatcgacgagatcggattgatgatcacc
catattgatgaaagaggatttttacactttgtcacgctcggcggaattgaccagagaacc
ttgctttaccaggaaatcctggtacacggaaaggaagagctgcggggcgtagtttgcctg
ggatcttcccacaaggacagcaaaaaacagcagaccctcgatatagaggatctggtgatc
gatatcggttttaatgatgcagcggcagttcaaatggtcaaaccgggagatatcgccagc
atcaaaagatgcccactgcatctgctcaacgacagaatatccggcaaagcgcttgacgac
agagctggagtcgcagtactggctgtatgcctgaacgaactgatgggtatgaaacatcag
catgatgtggtagcggtcgctacggttcaggaagaagtgggtttaagaggagggcttacc
agctcagagcgacttctgccgtcgctggcagttgccgttgatgtgacgcatgcccaaacg
ctggataccaaaagtcaggtttccgctgaactggcgaaaggaccggtgatcagtctcggt
ccgaatatccatccctgggtctacgccaggctctccgacagtgcacagcagaacaggatt
gcctgtcagcggcaggcggtccccggggcaacaggcaccgatgccagagtaattcagctg
accggttatggtataccgaccgggctggtctccatacctctccggtatatgcatacgtcc
gtcgagacggcctcgctgcaggatattgttgaatgcggcaagctgctggcgtatttcatt
gcgtcgttgccggaagaattggaggaactctaa

DBGET integrated database retrieval system