KEGG   Dehalobacter sp. DCA: DHBDCA_p589Help
Entry
DHBDCA_p589       CDS       T02278                                 

Definition
(GenBank) Cellulase M-related protein
Organism
ded  Dehalobacter sp. DCA
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
589498..590553
Genome map
AA seq 351 aa AA seqDB search
MLLKELSELNGVSGNEKTVRDFILEHLKYRLQEKLNSCRTDQIGNLLIEKKGIEKGSGEK
MPKVLVCAHMDEIGLMVTEITADGYLKFQTVGGIEPGILIAKTVVFSGGLQGVIGLKAVH
LQKTEERKKIPDVEDLYIDIGASSKAEAENVVKLGDYVTFPTIFEEIGSGLYKGKALDDR
VGCAAIMELLEQDYPCDLTAVFTVQEEVGLRGSKVVSNYLQADLALVVEATRAADFTESE
RENWIVTLGNGPACSLMDSATVYKPGLVQKVMAAAAKNNIPLQFRQGAAAANDAGNIHQA
GIGIPTITLSVPCRNIHTMSSIISKNDYQHCVRLLQCILNDIHDFLNLNIS
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atgctgttaaaagaattatctgaacttaacggcgtatccggtaatgaaaagactgtcagg
gattttattctggaacatcttaaataccgactccaggaaaagttaaattcctgcaggacg
gatcaaatcggaaatctactgatagagaaaaaagggattgaaaaaggttccggtgaaaaa
atgccaaaagtcctggtttgtgcccatatggatgaaatcggcctgatggttacggaaatt
actgcggatggctatctgaagtttcagactgtcggcggtattgaaccggggatcctgata
gctaagactgtcgtattcagcggcggtctgcagggcgtcatcggtttgaaagctgttcat
ttacagaaaacggaggaaagaaaaaaaatcccagatgttgaggatctctacatcgatatc
ggggcatcctcgaaggcagaagcagagaacgttgtgaagctgggcgattacgtcacattc
ccaacaatatttgaagagattggttcaggactgtacaaaggaaaagctcttgatgacagg
gtgggctgtgcggcgatcatggagctcttagaacaggattatccttgtgatctgacagcc
gtattcacagtacaggaggaggtcggcctgcgcggatcgaaagtggtaagcaattatctt
caggctgatctggcactggttgttgaggcgacacgcgctgctgattttactgaatccgaa
cgggaaaactggattgtcacactaggaaacggtccggcctgttcgctgatggattccgca
accgtctataaacctggactcgtccaaaaagtgatggctgcagctgcaaaaaataatatt
ccgctccaattcagacaaggggctgccgcggccaatgatgcaggaaatatccatcaggcc
ggtatcggcatacctacgattacactcagtgtaccctgccggaatattcataccatgagc
tccatcatttcaaagaatgattatcagcactgcgtgcggcttcttcaatgcattttaaat
gacattcacgatttcttaaatcttaatatttcttaa

DBGET integrated database retrieval system