KEGG   Dehalobacter sp. DCA: DHBDCA_p673Help
Entry
DHBDCA_p673       CDS       T02278                                 

Definition
Acetyl-coenzyme A synthetase (EC:6.2.1.1)
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
ded  Dehalobacter sp. DCA
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:ded00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    DHBDCA_p673
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    DHBDCA_p673
   00620 Pyruvate metabolism
    DHBDCA_p673
   00640 Propanoate metabolism
    DHBDCA_p673
  Energy metabolism
   00680 Methane metabolism
    DHBDCA_p673
Enzymes [BR:ded01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     DHBDCA_p673
Lipid biosynthesis proteins [BR:ded01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   DHBDCA_p673
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(686149..687831)
Genome map
AA seq 560 aa AA seqDB search
MNLASRYIGKTDFDSYEDFCANYQVKVPDNFNFAYDIVDEYGRLEPERPALVWCDDHGNE
RIFTFADLKKYSDKTANMLSEAGIRKGDKVMLILRRRYEVYIAILALAKIGAIYIPSSNQ
LTQKDIIYRNNAASIKAIIAYHDPVILDHVEASREESSTLETLFLVGARRPGWVDFDSSM
EAASENWVRPTGADATTNDDTMIIYFTSGTTSMPKMAIQSFTYPLGHIVTAKYWQRVVDG
GLHLTVSDSGWAKFGWGKIYGQWICGAVQFVYDMDKFIPEKLLEMMQKYKLSTFCAPPTI
YRFLLEHNLEKYNLSSIVHCSTAGEPLNPDVFNRFKSITGLSILNGFGQSETTVLVANFE
WLDIYPGAMGKPNPAYKIDVVDENGAPCPPGVEGELVIREADSNKPAGLFCGYYMDETAT
NKVWYDDTYHTGDMAYWDEHGFLWFVGRNDDVIKASGYRISPFEVESALIEHPAVVECAV
TGAPDAVRGTVVKATVVLAKGYTASELLKKEIQDYVKKVTAPYKYPRILEFVDELPKTIG
GKIKRAQIRREDTEKFQDKE
NT seq 1683 nt NT seq  +upstreamnt  +downstreamnt
atgaacctcgcttcaagatatatcgggaaaaccgattttgattcttatgaagatttttgt
gcgaattatcaagtgaaagtacctgacaattttaattttgcgtatgatatcgtcgatgaa
tatggccgtctggaaccagagcgtccagcgctggtctggtgcgacgaccatggtaatgaa
cggatctttacctttgccgacctgaaaaaatactcggataaaacggcgaacatgttaagc
gaagccgggatccgcaaaggcgacaaagtcatgctgattctgagaaggcgttatgaagtg
tacatagcgattctggctctggccaaaatcggcgcgatctatattccttcttccaatcag
cttacgcagaaggatattatttatcgaaataatgccgcatcgattaaagcgatcattgcc
tatcatgatccggtaattctcgaccatgtcgaagcttccagggaagaatcgtcaacgctc
gaaacgctgtttctagttggggcccggcgtcccggctgggttgattttgacagcagcatg
gaggctgcttccgaaaactgggtccggccaacaggtgctgatgcgacaacgaatgacgac
acaatgatcatctatttcacgtcagggaccacgagcatgcccaaaatggccattcagagc
ttcacctatccgcttggtcatattgtgacggctaaatactggcagcgcgtcgtggacggc
gggcttcaccttacggtttccgattccggctgggctaaattcggctgggggaaaatttac
ggccagtggatttgcggcgcagtgcagtttgtctatgatatggacaagtttatccctgaa
aagcttttggaaatgatgcaaaaatataagctgtccacgttttgtgcaccgccgacaatt
tatcgcttcctgcttgaacacaatcttgaaaaatataacctgtcctcgattgttcactgc
tccacagccggagagcccttaaatccggatgtctttaaccgttttaaaagcattaccggc
ttaagcatcttaaacggatttggccagagcgagacgaccgtgctggttgccaattttgaa
tggctggatatttatccaggagcgatgggcaaaccgaatccagcctacaagattgatgtg
gtcgatgaaaacggagctccatgccctccgggagtcgaaggagaactggttatccgcgag
gctgattccaataagcctgccggattgttctgcgggtactacatggatgaaactgctacc
aataaagtgtggtatgacgatacgtaccacacaggggatatggcctactgggatgaacac
ggctttttatggtttgttggccgcaatgacgatgtcattaaggcttccggctacaggatc
agtccttttgaagttgaaagtgcactaattgagcatcccgcagtcgtggagtgtgctgtt
accggcgcgccggatgccgtcaggggaacggtcgtcaaagcgactgttgtgctggccaaa
ggctatacggcctctgaattgctaaaaaaagagatccaggactatgtcaaaaaggtgaca
gctccgtataaatacccgagaattctcgaatttgtcgacgaactgccgaagacgatcggc
ggcaagatcaaacgcgcccagatccggcgtgaagacacggaaaagtttcaagataaagaa
taa

DBGET integrated database retrieval system