KEGG   Dehalobacter sp. DCA: DHBDCA_p717Help
Entry
DHBDCA_p717       CDS       T02278                                 

Definition
Tryptophan synthase beta chain like protein (EC:4.2.1.20)
Orthology
K06001  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
ded  Dehalobacter sp. DCA
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:ded00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    DHBDCA_p717
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    DHBDCA_p717
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    DHBDCA_p717
Enzymes [BR:ded01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     DHBDCA_p717
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
744520..745899
Genome map
AA seq 459 aa AA seqDB search
MKTMTSIPYKIYLPEEEMPKYWYNVKAVMKELPPPFIHPGTMKPCTADDLRPIFCDELIE
QELNNTDEYIEIPEEVREYYRMYRPSPLVRAYNLEKLLDTPAEIYFKFEGTNTSGSHKLN
SAAAQVYYAKKQGLSSLTTETGAGQWGTALSMACAFYNIPLTVYMVKVSAEQKPYRKAVI
ETYGGKVIPSPSDTTEIGRKILAENPGTGGSLGCAISEAIETSVKTENCRYVLGSVLDHV
LLHQSVIGEETKLACDKYGIEPEMIIGCIGGGSNFGGLVAPFMGDKIRGKNNIEFIGVEP
ASCPSLTRGKYAFDFGDTGKTTPLIKMYTLGSGFIPSPNHAGGLRYHGMSGIVSKLYNDG
YMTARAVEQSKVFEAATAFARCEGILPAPESAHALRVAMDEALKCKETGQKKTILFGLTG
TGYFDMAAYMSYNAGTMTDYIPTDADLEKGFATLPKVDL
NT seq 1380 nt NT seq  +upstreamnt  +downstreamnt
atgaagaccatgacaagcataccttacaaaatctatttacctgaagaagagatgcccaag
tactggtataatgtaaaagctgttatgaaagagctcccgccgccctttatccatccgggc
accatgaagccttgcaccgcagatgatctgcggccgatcttctgtgatgaactgattgaa
caggaactgaacaacacggacgaatatattgaaattcctgaggaagttcgcgaatactac
aggatgtaccgtccttccccgctcgtgagagcctataatcttgaaaagctgctggataca
cctgcagagatctattttaaatttgaaggcacgaatacttcaggttcccacaaattaaac
tctgcagctgcccaggtttattacgccaaaaaacaggggctttcttcactgacaacggaa
accggtgccggacaatggggtacggccttatcgatggcctgtgcgttttataatattcca
ttaacggtctatatggtgaaggtatctgcagaacagaagccttaccggaaagctgtcatt
gaaacctatggcggaaaagtcattccatctccttccgacacgacggaaattggccggaag
attttggctgaaaaccccggcacaggcggttctcttggctgtgcgatttcggaagcgatt
gaaacatctgtcaaaaccgaaaactgtcgttatgtacttggcagcgtactcgaccatgtc
ctgctgcaccagtccgtgatcggcgaagaaaccaagcttgcctgtgacaaatacggcatt
gagcctgaaatgattattggctgtatcggcggcgggtcgaactttggcggtctggttgca
cctttcatgggtgacaagatccgcggcaaaaacaatatcgagtttattggtgttgaacct
gcctcctgcccttctctgacccgcggcaaatatgcgtttgattttggggatacaggaaaa
acgacacccctgatcaaaatgtatacgctcggatcagggttcattccctctccgaatcac
gccggaggcctcaggtatcacggtatgagcggaatcgtttccaaactgtacaatgacggc
tatatgacagcccgggcagttgaacagtccaaggtatttgaagcagctacagcctttgcg
cgctgtgaaggcatcctgcctgctccagaatccgcacatgctttgcgggttgcaatggat
gaagcgctcaagtgtaaagaaaccggtcaaaagaagaccatcctgtttggcctgactggc
accggatattttgatatggctgcttatatgagctataatgccggcacaatgacagactat
attccgaccgatgctgatctggaaaaaggctttgcaacgctgccaaaagtggatctgtag

DBGET integrated database retrieval system