KEGG   Dehalobacter sp. DCA: DHBDCA_p813Help
Entry
DHBDCA_p813       CDS       T02278                                 

Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
ded  Dehalobacter sp. DCA
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:ded00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    DHBDCA_p813
   01230 Biosynthesis of amino acids
    DHBDCA_p813
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    DHBDCA_p813
   00030 Pentose phosphate pathway
    DHBDCA_p813
   00051 Fructose and mannose metabolism
    DHBDCA_p813
   00052 Galactose metabolism
    DHBDCA_p813
  Energy metabolism
   00680 Methane metabolism
    DHBDCA_p813
Enzymes [BR:ded01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     DHBDCA_p813
Protein phosphatases and associated proteins [BR:ded01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     DHBDCA_p813
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(854712..855680)
Genome map
AA seq 322 aa AA seqDB search
MGADSKVAVLTSGGDAPGMNTAIRAIVRKGIYHDLRVYGVFHGYDGLLRGEIKEMELGSV
ADIVHRGGTVLKTARCEEMFTAEGQRLAADQLKAKGIEALVVIGGDGSYRGAKKLAELGI
KVIGVPGTIDNDIAGTDSTIGFDTAVNTVVEAVSKLRDTASSHERTFLVEVMGRNCGDIA
LHSGLAIGAESILTPEIPFDLQEISEKLLRGYRRGKNHSIIICAEGAGDIREIASGLKKY
SGLENRVTILGHIQRGGAPSAADSLLGAMMGGKAIEALMEGKSEVMISHFQNEIVDRPLE
LAFKEKKMFNRKLYELANELAI
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgggcgcggatagcaaggttgcagttttaaccagcggaggggatgctcccggaatgaac
accgcgatacgggcgattgttcgtaagggcatttaccatgatctccgggtatatggggtt
ttccatggttatgatgggcttctgcgcggtgaaataaaagaaatggagctgggctcagtt
gcagatattgtgcatcgcggcggaacggttctgaaaactgccagatgtgaagaaatgttt
acggctgaaggccaacgtctggccgcggaccagctaaaggccaaaggaatcgaagcgctc
gtggtcattggcggagacggttcttaccgcggagcaaaaaaacttgctgaattgggtatc
aaagtcattggcgtgcccggtacgattgacaatgacattgctggaacagattcaacgatt
ggctttgacacggcggtgaacaccgttgtcgaggctgtaagcaaattaagagacaccgct
tcgtcccatgaacggacttttcttgtcgaagtcatgggcagaaactgcggggatattgcc
ctccactcaggactcgcgattggtgccgaatcgatcctgacgcccgaaatcccttttgat
cttcaggaaattagtgagaaactgctgcggggatatcggagaggaaaaaatcacagtatt
attatttgtgctgaaggagcaggggatatccgtgaaattgcttcaggcttaaagaaatat
tccggattggaaaaccgagtgacgattctcggccacattcaacgcggaggagcaccctcg
gcagccgattctttgctcggagcaatgatgggcggcaaggccattgaggcactgatggag
ggaaaatctgaggtgatgatctctcattttcaaaatgagattgtggacaggccattggaa
cttgcttttaaggaaaagaaaatgtttaaccgtaaactctatgagctggctaacgagctg
gctatttaa

DBGET integrated database retrieval system