KEGG   Dehalococcoides sp. GT: DehalGT_0034Help
Entry
DehalGT_0034      CDS       T01182                                 

Definition
guanylate kinase (EC:2.7.4.8)
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
deg  Dehalococcoides sp. GT
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:deg00230]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(30930..31547)
Genome map
AA seq 205 aa AA seqDB search
MTNWNFNKAEKPLLLIVSGPSGVGKDAVLARMKERKLPLTYIVTTTTRPKRETETEGVDY
NFIRPAEFQELISQNELLEWANVYGNFYGVPKAPIRQALSRGSDVIVKVDVQGAASIKKI
VPNAVFIFLMPPDMDELTRRLEHRLTESPESLRRRLATAPLEIEKLPDFDYVVVNPEGEI
DNAVREIMSIIAAEHCRIQPRLIEL
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
atgacaaactggaactttaataaagctgaaaaacccctgctgttgattgtttccggtcct
tccggcgtaggtaaagatgcagttctggcccgtatgaaagagcgcaaactgcccctgacc
tatatagtcacaaccaccacccgccccaaacgggaaaccgaaaccgagggagttgattat
aattttatcagaccggctgaatttcaagagcttatcagccagaatgaactgctggaatgg
gctaacgtttacggaaatttttacggcgtccccaaagcgcctatcaggcaagccttatcc
cgcggttcagacgttattgtaaaagtggacgttcagggtgcggccagcatcaaaaaaata
gtgccgaatgcggtatttattttcctgatgcccccggatatggacgaactgacccgccgt
ctggaacaccgcctgaccgaatcacccgaatccctcagacggcgactggctactgccccg
ctcgaaatagaaaaactccccgactttgactacgtggtagtcaacccagagggggagatt
gataatgctgtccgtgagattatgtctattattgcggccgaacactgccgcatacagccc
cgtttaattgaactttag

DBGET integrated database retrieval system