KEGG   Dehalococcoides mccartyi GT: DehalGT_0049Help
Entry
DehalGT_0049      CDS       T01182                                 

Definition
ROK family protein
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
deg  Dehalococcoides mccartyi GT
Pathway
Glycolysis / Gluconeogenesis
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:deg00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    DehalGT_0049
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    DehalGT_0049
   00052 Galactose metabolism
    DehalGT_0049
   00500 Starch and sucrose metabolism
    DehalGT_0049
   00520 Amino sugar and nucleotide sugar metabolism
    DehalGT_0049
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    DehalGT_0049
   00524 Butirosin and neomycin biosynthesis
    DehalGT_0049
Enzymes [BR:deg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     DehalGT_0049
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
40438..41445
Genome map
AA seq 335 aa AA seqDB search
MNRSNSEVMSKPCLCLDIGGSKIRSAVVTHDGRVVAWEQEPTCARNGVTGVFESICRVLD
RLLARNNLNTSQFEALAAAVAGGIDMPNGLVTQSPHLPDWRDVPLRDMLTERYLKTFIIN
DASAAALGEHRLGVGLGVKNLVYLTVSTGIGGGIIINNELYLGQSGCAGEIGHMCLDING
KEDVCGNKGCLETLASGTAIVSRVQTELAGGEFSILVERFKADYSALTAEDIGRAASEGD
RLCLGIIRQAGEYLGIGLVNIANIFNPELIILGGGVSKLGEIFIEPARQVLYKRAFRLAG
DDVRLIVSVLGDNAGVIGAALYAYACLDSANNQPQ
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
ttgaaccgtagtaattcagaggttatgagcaagccctgtttgtgtctggatataggcggc
agtaaaatccgttcggcggtggtcacccatgacggacgggtggtggcttgggaacaggag
cctacctgtgcccgaaacggggtaacgggtgtatttgagagtatctgccgggtgcttgac
cgcttgcttgcgcgtaacaacctgaatacctcacagtttgaggcacttgctgcggcagtt
gccgggggtatagatatgccaaacgggctggttacccagtctccccatttgcccgactgg
cgggacgtgcccctcagggatatgcttacagaacgttatctcaagacctttattataaat
gatgcttcggccgccgcactgggtgaacaccgtctgggagtggggctgggagttaaaaat
ctggtttacctgaccgtttccaccggtatcgggggcggtattattataaataacgagctg
tatctggggcagagcggctgtgccggtgaaatagggcatatgtgtctggatataaacggc
aaggaagatgtctgcggcaacaaaggctgtttggaaacactggcttcgggtacggctatt
gtcagcagggttcagaccgaacttgctgggggtgaattttccatactggtagaacgcttc
aaggcggattattcggctttgaccgcagaggatataggcagggcggcttcagagggtgac
aggctgtgtctggggattatccgtcaggcaggggaatatctgggaatcgggctggtgaat
attgccaatatatttaacccggagcttattatactggggggcggggtttccaagctggga
gagatatttattgagcctgcccgccaagtgctttataaacgggctttccgtctggcgggg
gatgatgtccgcctgatagtttcggttctgggggataatgccggggtgattggggcagct
ctgtatgcctatgcctgtctggatagtgcgaacaaccagcctcagtga

DBGET integrated database retrieval system