KEGG   Dehalococcoides sp. GT: DehalGT_0049Help
Entry
DehalGT_0049      CDS       T01182                                 

Definition
ROK family protein
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
deg  Dehalococcoides sp. GT
Pathway
Glycolysis / Gluconeogenesis
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:deg01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:deg00010]
Metabolism; Carbohydrate metabolism; Galactose metabolism
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:deg00500]
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:deg00520]
Metabolism; Biosynthesis of other secondary metabolites; Streptomycin biosynthesis [PATH:deg00521]
Metabolism; Biosynthesis of other secondary metabolites; Butirosin and neomycin biosynthesis
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
40438..41445
Genome map
AA seq 335 aa AA seqDB search
MNRSNSEVMSKPCLCLDIGGSKIRSAVVTHDGRVVAWEQEPTCARNGVTGVFESICRVLD
RLLARNNLNTSQFEALAAAVAGGIDMPNGLVTQSPHLPDWRDVPLRDMLTERYLKTFIIN
DASAAALGEHRLGVGLGVKNLVYLTVSTGIGGGIIINNELYLGQSGCAGEIGHMCLDING
KEDVCGNKGCLETLASGTAIVSRVQTELAGGEFSILVERFKADYSALTAEDIGRAASEGD
RLCLGIIRQAGEYLGIGLVNIANIFNPELIILGGGVSKLGEIFIEPARQVLYKRAFRLAG
DDVRLIVSVLGDNAGVIGAALYAYACLDSANNQPQ
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
ttgaaccgtagtaattcagaggttatgagcaagccctgtttgtgtctggatataggcggc
agtaaaatccgttcggcggtggtcacccatgacggacgggtggtggcttgggaacaggag
cctacctgtgcccgaaacggggtaacgggtgtatttgagagtatctgccgggtgcttgac
cgcttgcttgcgcgtaacaacctgaatacctcacagtttgaggcacttgctgcggcagtt
gccgggggtatagatatgccaaacgggctggttacccagtctccccatttgcccgactgg
cgggacgtgcccctcagggatatgcttacagaacgttatctcaagacctttattataaat
gatgcttcggccgccgcactgggtgaacaccgtctgggagtggggctgggagttaaaaat
ctggtttacctgaccgtttccaccggtatcgggggcggtattattataaataacgagctg
tatctggggcagagcggctgtgccggtgaaatagggcatatgtgtctggatataaacggc
aaggaagatgtctgcggcaacaaaggctgtttggaaacactggcttcgggtacggctatt
gtcagcagggttcagaccgaacttgctgggggtgaattttccatactggtagaacgcttc
aaggcggattattcggctttgaccgcagaggatataggcagggcggcttcagagggtgac
aggctgtgtctggggattatccgtcaggcaggggaatatctgggaatcgggctggtgaat
attgccaatatatttaacccggagcttattatactggggggcggggtttccaagctggga
gagatatttattgagcctgcccgccaagtgctttataaacgggctttccgtctggcgggg
gatgatgtccgcctgatagtttcggttctgggggataatgccggggtgattggggcagct
ctgtatgcctatgcctgtctggatagtgcgaacaaccagcctcagtga

DBGET integrated database retrieval system