KEGG   Dehalococcoides mccartyi GT: DehalGT_0049Help
Entry
DehalGT_0049      CDS       T01182                                 

Definition
(RefSeq) ROK family protein
  KO
K00845  
glucokinase [EC:2.7.1.2]
Organism
deg  Dehalococcoides mccartyi GT
Pathway
Glycolysis / Gluconeogenesis
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:deg00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    DehalGT_0049
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    DehalGT_0049
   00052 Galactose metabolism
    DehalGT_0049
   00500 Starch and sucrose metabolism
    DehalGT_0049
   00520 Amino sugar and nucleotide sugar metabolism
    DehalGT_0049
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    DehalGT_0049
   00524 Butirosin and neomycin biosynthesis
    DehalGT_0049
Enzymes [BR:deg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     DehalGT_0049
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
JGI: 
Position
40438..41445
Genome map
AA seq 335 aa AA seqDB search
MNRSNSEVMSKPCLCLDIGGSKIRSAVVTHDGRVVAWEQEPTCARNGVTGVFESICRVLD
RLLARNNLNTSQFEALAAAVAGGIDMPNGLVTQSPHLPDWRDVPLRDMLTERYLKTFIIN
DASAAALGEHRLGVGLGVKNLVYLTVSTGIGGGIIINNELYLGQSGCAGEIGHMCLDING
KEDVCGNKGCLETLASGTAIVSRVQTELAGGEFSILVERFKADYSALTAEDIGRAASEGD
RLCLGIIRQAGEYLGIGLVNIANIFNPELIILGGGVSKLGEIFIEPARQVLYKRAFRLAG
DDVRLIVSVLGDNAGVIGAALYAYACLDSANNQPQ
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
ttgaaccgtagtaattcagaggttatgagcaagccctgtttgtgtctggatataggcggc
agtaaaatccgttcggcggtggtcacccatgacggacgggtggtggcttgggaacaggag
cctacctgtgcccgaaacggggtaacgggtgtatttgagagtatctgccgggtgcttgac
cgcttgcttgcgcgtaacaacctgaatacctcacagtttgaggcacttgctgcggcagtt
gccgggggtatagatatgccaaacgggctggttacccagtctccccatttgcccgactgg
cgggacgtgcccctcagggatatgcttacagaacgttatctcaagacctttattataaat
gatgcttcggccgccgcactgggtgaacaccgtctgggagtggggctgggagttaaaaat
ctggtttacctgaccgtttccaccggtatcgggggcggtattattataaataacgagctg
tatctggggcagagcggctgtgccggtgaaatagggcatatgtgtctggatataaacggc
aaggaagatgtctgcggcaacaaaggctgtttggaaacactggcttcgggtacggctatt
gtcagcagggttcagaccgaacttgctgggggtgaattttccatactggtagaacgcttc
aaggcggattattcggctttgaccgcagaggatataggcagggcggcttcagagggtgac
aggctgtgtctggggattatccgtcaggcaggggaatatctgggaatcgggctggtgaat
attgccaatatatttaacccggagcttattatactggggggcggggtttccaagctggga
gagatatttattgagcctgcccgccaagtgctttataaacgggctttccgtctggcgggg
gatgatgtccgcctgatagtttcggttctgggggataatgccggggtgattggggcagct
ctgtatgcctatgcctgtctggatagtgcgaacaaccagcctcagtga

DBGET integrated database retrieval system