KEGG   Dehalococcoides mccartyi GT: DehalGT_0348Help
Entry
DehalGT_0348      CDS       T01182                                 

Definition
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
deg  Dehalococcoides mccartyi GT
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:deg00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    DehalGT_0348
Enzymes [BR:deg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     DehalGT_0348
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
329094..329948
Genome map
AA seq 284 aa AA seqDB search
MLTLLAPAKVNLSLEVLYRRKDGYHELRSIIQSLSLCDRLSFSPSKTVHISSDSQDWQAD
LSLVSKAVELFSERCGQNTGVNLKIAKRIPLVSGLGGDSSCAAAVLKGLNKLWGCGYPCW
RLMEIGAELGSDVPFFIMGGTAMMEGRGETVTPLPTLTQMWAVLLVPALDMPADKTAALY
RNLRPDSFTSGEISDKLLESICQGKLSLSLCFNAFEKVAFELFPELVKYRWQFLEAGAYQ
ISLAGAGPTLFTLLKDKNTAEKIYHNLCQKGHQAYLVSTLGPLD
NT seq 855 nt NT seq  +upstreamnt  +downstreamnt
atgctgacattgctggctcctgccaaagtcaaccttagtctggaagtgctataccgcaga
aaagacggataccatgaattgcgaagcattatccagtctctaagcctgtgtgaccgcctg
tctttcagcccttctaaaacggtacatataagttcagacagccaggactggcaggctgac
cttagtctggtttcaaaagcagtggaactgtttagtgaaagatgcgggcagaacacaggg
gtaaacctgaaaatagccaaacgtattccactggtttccgggctggggggagacagttcg
tgtgcggcggctgttttgaaaggacttaacaagctttgggggtgcggttatccctgctgg
cgtttgatggagataggtgcagagctgggttctgacgtgccgttttttataatgggcggt
acggccatgatggaagggcggggagaaacagtaactcctctgcctacccttactcaaatg
tgggcggttttactggtgccggcgcttgatatgccggctgataaaactgctgccctttac
cgaaatttgcgcccggatagctttaccagcggagagataagtgacaagctgctggaaagt
atttgtcagggtaagctcagcctcagcctttgttttaacgcctttgagaaagtagctttt
gagcttttccccgaactggtcaaataccgctggcagtttctggaagcaggggcttaccag
atatctttagccggggcaggaccgaccctgttcaccctgcttaaagataaaaacactgct
gaaaagatataccataacctgtgccaaaaagggcatcaggcctatctggtgtccacttta
gggccgctggattga

DBGET integrated database retrieval system