KEGG   Dehalococcoides mccartyi GT: DehalGT_0519Help
Entry
DehalGT_0519      CDS       T01182                                 

Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
deg  Dehalococcoides mccartyi GT
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:deg00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    DehalGT_0519
DNA repair and recombination proteins [BR:deg03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      DehalGT_0519
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(481112..481726)
Genome map
AA seq 204 aa AA seqDB search
MKDTSLPSTAGVVNKLIDSLGKLPGIGPKSAQRLAFYLMRAPEDQVISLSDTIRNIKNQI
SQCRICCNVADSELCPICQNTKRETNKICVVEQPQDILALEHVGVYRGYYHVLHGAISPT
EGITSQNIRINELMVRLDNGQVEEIILATNPTTEGEATAMYLSRLITPLGIKVTRLARGL
PFGTELEYADDVTLSRAMEGRQNF
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
ttgaaggacacttctttaccgtctacggccggtgtggtaaacaagctgatagattcactg
ggcaaactgccgggtataggcccgaaaagcgcccagcgtctggcattttaccttatgcgg
gcacctgaagatcaggttatttccctctcagacactatccgcaatataaaaaaccagata
agccagtgccgcatttgctgtaacgtggctgatagtgagctttgccccatttgccagaat
accaaacgcgaaacaaataagatttgcgtggttgaacagcctcaggatattctggctctt
gaacatgtaggtgtctaccgcggatactaccatgtactgcatggagctatttcccccacc
gaagggataacctcccagaacatacgtataaacgagcttatggttcggctggataatggt
caggtagaagagattattctggctaccaatcccactaccgaaggtgaagccaccgccatg
tacctttcgcggctgataaccccactgggtataaaagtgaccagactggcacggggctta
cccttcgggacagaactggaatatgctgacgatgtaactttaagccgagccatggaggga
cgccagaacttttag

DBGET integrated database retrieval system