KEGG   Dehalococcoides mccartyi GT: DehalGT_0548Help
Entry
DehalGT_0548      CDS       T01182                                 

Definition
(GenBank) histone acetyltransferase, ELP3 family
  KO
K07739  
elongator complex protein 3 [EC:2.3.1.48]
Organism
deg  Dehalococcoides mccartyi GT
Brite
Enzymes [BR:deg01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     DehalGT_0548
Transfer RNA biogenesis [BR:deg03016]
 Eukaryotic Type
  tRNA modification factors
   Elongator complex
    DehalGT_0548
Chromosome [BR:deg03036]
 Eukaryotic Type
  Histone modification proteins
   HATs (histone acetyltransferases)
    DehalGT_0548
   HAT complexes
    Elongator complex
     DehalGT_0548
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
Structure
PDB: 

Jmol
Position
513293..514672
Genome map
AA seq 459 aa AA seqDB search
MKKLSRTISGVTPVAVMTKPLPCPGKCIYCPTFAATPQSYTPESPAVLRAKSCEYQAYKQ
VALRLRIIQDMGHPTDKVELIIMGGTFLSADITYQYGFIKDCYDALNGVVAGSLEEAKTI
NETAQHRCVGLCIETRPDICGKAEIQRMIDFGTTRVELGVQMLDDDIYKMVERGHTVADV
AEATCLLREYGLKVHYHWMPGLPGSSPEKDLALSRMVFEDPRFCPDGLKLYPTMVVEGTI
LEQWWKEGRYTPYPNGTMTGLIADIKALVLPYVRISRVLRDIPAVFISAGLKDSLRDGVR
QILESRHQKCRCIRCREYGHRQRKGQTSGEPTLRRLDYPASGGKEIFLSFEDVSDTLYGL
LRLRIPCASLSVLDQKYGAKTGLVRELHVYGIELSLGEQGDQSAQHRGLGRKLLAEAERL
ARDEFGLDSLAILSGVGAREYYRSLGYELVAGYMCKHLD
NT seq 1380 nt NT seq  +upstreamnt  +downstreamnt
atgaagaagctttcccgaacaatatcaggtgttaccccggtggcggttatgaccaagccg
ctaccatgccccggcaagtgcatttattgccccacttttgccgctactccccaaagctat
acacctgaatctccggctgttttgcgggctaaaagctgtgaataccaggcttataaacag
gttgcccttcgcctgaggataatacaggacatgggacaccctacggataaggttgagctt
ataatcatgggtggcactttcctttcggcagatatcacttaccagtacggctttattaaa
gattgctacgacgctttgaacggagtggtggccggcagtctggaagaagccaaaaccata
aatgaaaccgcccagcaccgctgtgtgggtttatgtattgaaacccgtccggatatttgc
gggaaggccgaaatacaacggatgatagatttcgggactaccagagtggaacttggcgtc
cagatgctggatgatgatatttataagatggttgaacggggacatacagtggcagatgtg
gctgaggctacgtgtcttctgcgtgaatacggacttaaagtgcattaccactggatgccc
ggacttcccggctcttctcctgaaaaagatctggcactttcccggatggtgtttgaagac
ccgcggttttgccctgacgggcttaagctttatcccactatggtagtggaaggaactata
ctagaacagtggtggaaagagggaaggtacaccccctatcccaatggcaccatgaccggg
ctgattgcggatatcaaagcactggtgctgccttacgtgcgtatttcacgggtacttcgg
gatataccggctgtatttattagcgccggcctcaaagactccctgagggacggggttcgc
cagatactggaaagccgccaccagaagtgcaggtgcatacgttgccgtgaatacggccac
cgccagcggaaagggcagaccagcggtgaacctaccttaaggcgtcttgattatcctgcc
tcaggtggcaaggagatattccttagctttgaagatgtctctgacactctgtatggtctg
ctcagattgcgtataccctgtgcatcgctgtctgttcttgatcagaaatatggtgctaaa
acagggctggtgcgtgaactgcatgtgtatggcatagagctttcactaggggaacaggga
gaccagtctgcccagcaccggggtcttggccggaaactgctggcggaagcggagcgttta
gcccgtgatgaattcggtcttgactcactggctattttaagcggggtgggtgccagagag
tattacaggtcactggggtatgaactggtggctgggtatatgtgcaagcacttagactga

DBGET integrated database retrieval system