KEGG   Dehalococcoides mccartyi GT: DehalGT_0608Help
Entry
DehalGT_0608      CDS       T01182                                 

Definition
PfkB domain-containing protein
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
deg  Dehalococcoides mccartyi GT
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:deg00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    DehalGT_0608
Enzymes [BR:deg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     DehalGT_0608
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(573908..574894)
Genome map
AA seq 328 aa AA seqDB search
MTTCSLEAIGLGAVHVDHIYTVEQILHDGECVVTESASFPGGSGANTIHGLSRLGLKCGF
IGAVGNDSDGNLLIKDFENAGIDNQYLMVTDEAQTGSVVSLSESSGRRSTYVNPGANNYL
NLSDINLEYLSQAKLVHMSTFFSQNEFALCHEIAERLAPDVLFSFSPGALFAAQGLKRLA
PILSRTNALFTNQLDIEKMTQKNYQRATDMCIRSGCEHVVVTLGESRRFQRKGKITLQTY
IRDKDHECHMESTVSLRKDIRTVVDTIGAADAFTTGFLFGLMGDKPIEECGLLGDISARF
CISKLGARSGLPNLEGLKERFGMHYFTN
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
atgactacttgtagtcttgaggctatcggcttgggggcggtgcatgtagatcatatatat
actgtggagcaaatactccatgacggcgaatgtgtagtcaccgaatctgcctcattcccc
ggcggttcaggtgcaaatactatacatgggttatcccggctgggattaaaatgcggcttc
ataggagcagtgggaaatgactctgacggcaacctgttgattaaagactttgaaaacgca
ggtatagataaccagtacctgatggtaacggacgaagcccaaacgggctcagtggtttca
ctaagtgaatcttccgggcgccgctcaacatatgtaaatcccggtgccaacaattacctt
aacctttctgatatcaatctggagtacttaagccaagccaagctggttcatatgtcaact
ttcttcagccagaatgaatttgccctttgccatgaaatagcggaacggctggcaccggat
gtacttttcagcttttcacccggagccctctttgccgcccaggggctgaaaaggcttgct
cccattctttcacgcacaaatgcccttttcaccaaccaactggatatagagaaaatgacc
caaaagaattatcagcgggctacggatatgtgtatccgcagcggatgtgaacatgtggta
gttactctgggagagagccgccgttttcaacgaaaaggcaaaataaccctccagacctat
atacgggacaaagaccacgagtgccatatggagtcaaccgtcagcctcaggaaagatatc
cgtaccgtagtggatacaataggtgcggcagatgcctttaccaccggtttccttttcggg
cttatgggggataaacccattgaagagtgcggcttgctgggggatatttctgcccgtttc
tgcataagcaagctgggtgcccgttcaggtttgcccaatctggaaggactaaaagaacgc
ttcggcatgcactattttactaactga

DBGET integrated database retrieval system