KEGG   Dehalococcoides mccartyi GT: DehalGT_0617Help
Entry
DehalGT_0617      CDS       T01182                                 

Definition
(GenBank) pyruvate/ketoisovalerate oxidoreductase, gamma subunit
  KO
K00172  
pyruvate ferredoxin oxidoreductase gamma subunit [EC:1.2.7.1]
Organism
deg  Dehalococcoides mccartyi GT
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Nitrotoluene degradation
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:deg00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    DehalGT_0617
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    DehalGT_0617
   00020 Citrate cycle (TCA cycle)
    DehalGT_0617
   00620 Pyruvate metabolism
    DehalGT_0617
   00640 Propanoate metabolism
    DehalGT_0617
   00650 Butanoate metabolism
    DehalGT_0617
  Energy metabolism
   00680 Methane metabolism
    DehalGT_0617
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    DehalGT_0617
Enzymes [BR:deg01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     DehalGT_0617
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
Position
584405..584977
Genome map
AA seq 190 aa AA seqDB search
MKHFIEIRWHGRGGQGAVTSAELIAQAAIGKGKYAQAFPSFGPERRGAPVQSFNRISDNN
PIRERSGINQPDIVVVLDPSLVIIGNVISGLKDGGTLIINTTKPLEHFASQYGDRWKVAT
VDATAIAKEVLGVNIVNTTMLGALIKATGLADMEAFEEPLKHRFGKLAAKNMAAMKKAFE
ETVVKELKVG
NT seq 573 nt NT seq  +upstreamnt  +downstreamnt
atgaaacattttattgaaatcagatggcatgggcgtggcggtcagggtgcggtaacctca
gctgagcttatcgcccaggcagcaatcggtaagggaaagtatgctcaggcattccccagt
ttcgggcctgaacgcagaggtgccccggttcaatctttcaatcgtatcagtgacaacaat
cccatccgtgaacgttcaggtatcaaccagccggatattgtggtggtgcttgaccccagt
ttggttatcatcgggaatgtaatctcaggtcttaaagatggtggcactcttattatcaac
accacaaagcctctggaacattttgcttctcaatacggtgatcgctggaaagtagccaca
gttgatgcaactgctattgccaaagaagtcttaggtgtcaatattgttaatacaaccatg
cttggcgcccttataaaggctaccggtctggcggatatggaagccttcgaagaaccttta
aaacaccgctttggaaagctggctgccaaaaatatggctgctatgaaaaaggcctttgaa
gagactgttgtaaaggagcttaaagttggctaa

DBGET integrated database retrieval system