KEGG   Dehalococcoides sp. GT: DehalGT_0618Help
Entry
DehalGT_0618      CDS       T01182                                 

Definition
pyruvate ferredoxin/flavodoxin oxidoreductase subunit delta
Orthology
K00171  
pyruvate ferredoxin oxidoreductase, delta subunit [EC:1.2.7.1]
Organism
deg  Dehalococcoides sp. GT
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Nitrotoluene degradation
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Pyruvate:ferredoxin oxidoreductase
Class
Metabolism; Overview; Carbon metabolism [PATH:deg01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:deg00010]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:deg00020]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:deg00620]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:deg00640]
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:deg00650]
Metabolism; Energy metabolism; Methane metabolism [PATH:deg00680]
Metabolism; Xenobiotics biodegradation and metabolism; Nitrotoluene degradation [PATH:deg00633]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
584970..585266
Genome map
AA seq 98 aa AA seqDB search
MAKQENQITWQEVTPGCIVSEPGNASQYKTGDWRSQLPIHNFKKCIKCGVCYIFCPEGCI
NETKEGFFEADLFYCKGCGICAHECPTGAIVMKDEEEK
NT seq 297 nt NT seq  +upstreamnt  +downstreamnt
ttggctaaacaggaaaaccagattacctggcaggaagtgacacccggctgtatagtcagt
gaacccggcaatgccagccagtacaagaccggtgattggcgttcccaactacctattcac
aattttaaaaaatgtataaaatgcggcgtatgctatatattttgccccgaaggttgcata
aatgagaccaaagagggctttttcgaagcagaccttttctattgcaagggttgcggcatc
tgcgctcatgaatgtcccaccggagctattgttatgaaggatgaggaggagaaataa

DBGET integrated database retrieval system