KEGG   Dehalococcoides mccartyi GT: DehalGT_0620Help
Entry
DehalGT_0620      CDS       T01182                                 

Definition
(GenBank) thiamine pyrophosphate protein domain protein TPP-binding protein
  KO
K00170  pyruvate ferredoxin oxidoreductase beta subunit [EC:1.2.7.1]
Organism
deg  Dehalococcoides mccartyi GT
Pathway
deg00010  Glycolysis / Gluconeogenesis
deg00020  Citrate cycle (TCA cycle)
deg00620  Pyruvate metabolism
deg00633  Nitrotoluene degradation
deg00640  Propanoate metabolism
deg00650  Butanoate metabolism
deg00680  Methane metabolism
deg01100  Metabolic pathways
deg01120  Microbial metabolism in diverse environments
deg01130  Biosynthesis of antibiotics
deg01200  Carbon metabolism
Module
deg_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:deg00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    DehalGT_0620
   00020 Citrate cycle (TCA cycle)
    DehalGT_0620
   00620 Pyruvate metabolism
    DehalGT_0620
   00640 Propanoate metabolism
    DehalGT_0620
   00650 Butanoate metabolism
    DehalGT_0620
  Energy metabolism
   00680 Methane metabolism
    DehalGT_0620
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    DehalGT_0620
Enzymes [BR:deg01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     DehalGT_0620
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TPP_enzyme_C DUF5394
Motif
Other DBs
NCBI-ProteinID: ADC73987
JGI: DehalGT_0620
Position
586438..587379
Genome map
AA seq 313 aa AA seqDB search
MQNYSVFVPKLLPKRELFAPGHRGCIGCGEALAVRLATKAMDENTIIVNATGCMEIIASQ
YPYTSWRLPWIHTLFENTAAVASGVESALKVLKRKKRIEDKDIKIVAIGGDGATVDIGLQ
ALSGAMERGHNFTYICFDNEAYMNTGIQRSSATPFGAATTTSPAGKVGKGQFSWKKDMPA
IAVAHNIPYVATCCPSYPFDMIEKVSKALAADGPAYIHCLSVCPTGWRCATEDTIKIGRL
AVETGVFPLYEVVNGEYKMSMETPALKPLKEYTSLQRRFRHLTEESLDLIQERVQLEYNK
IAERAACALKLEK
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
atgcagaactattcagtatttgttcccaagctactgcccaaacgtgagttatttgccccc
ggacatcgcgggtgcataggttgcggcgaggctctggcagtccgtctggctaccaaggct
atggatgaaaataccataatagtaaatgccaccggctgtatggaaattatcgcctcccag
tacccctatacctcatggcgtttaccctggatacatacgctgtttgaaaatacagcagca
gttgcctccggtgtggagtcggcgctcaaggtgcttaaacgtaaaaaacggatagaagac
aaggatataaagattgtagccatcgggggtgatggagcaaccgtagatatcgggcttcag
gcactttcgggtgctatggagcgcggccataattttacttatatctgttttgacaatgaa
gcctatatgaacaccggtatccagcgttcttcagctacccccttcggggcagccaccaca
acctcgccggccggcaaggtaggcaaaggccagttttcatggaaaaaggatatgccggct
attgcagttgcccataatatcccgtatgtggccacctgttgccccagctatccctttgac
atgattgaaaaagtcagcaaagctttggcggctgacgggccggcctatatacattgtttg
tctgtttgtcctaccggctggcgctgtgcaaccgaagataccataaagattggacggttg
gcagttgaaaccggtgttttccccctgtacgaggttgttaatggtgagtacaagatgagc
atggaaactcccgcacttaagccattaaaggaatacaccagtcttcagcggcggttccgc
cacctgacagaagaatctctggaccttattcaggaaagagttcagctggaatacaataag
attgcagagagggcggcatgtgcactgaaactagagaaatag

DBGET integrated database retrieval system