KEGG   Dehalococcoides mccartyi GT: DehalGT_0620Help
Entry
DehalGT_0620      CDS       T01182                                 

Definition
(GenBank) thiamine pyrophosphate protein domain protein TPP-binding protein
  KO
K00170  
pyruvate ferredoxin oxidoreductase beta subunit [EC:1.2.7.1]
Organism
deg  Dehalococcoides mccartyi GT
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Nitrotoluene degradation
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:deg00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    DehalGT_0620
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    DehalGT_0620
   00020 Citrate cycle (TCA cycle)
    DehalGT_0620
   00620 Pyruvate metabolism
    DehalGT_0620
   00640 Propanoate metabolism
    DehalGT_0620
   00650 Butanoate metabolism
    DehalGT_0620
  Energy metabolism
   00680 Methane metabolism
    DehalGT_0620
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    DehalGT_0620
Enzymes [BR:deg01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     DehalGT_0620
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
Position
586438..587379
Genome map
AA seq 313 aa AA seqDB search
MQNYSVFVPKLLPKRELFAPGHRGCIGCGEALAVRLATKAMDENTIIVNATGCMEIIASQ
YPYTSWRLPWIHTLFENTAAVASGVESALKVLKRKKRIEDKDIKIVAIGGDGATVDIGLQ
ALSGAMERGHNFTYICFDNEAYMNTGIQRSSATPFGAATTTSPAGKVGKGQFSWKKDMPA
IAVAHNIPYVATCCPSYPFDMIEKVSKALAADGPAYIHCLSVCPTGWRCATEDTIKIGRL
AVETGVFPLYEVVNGEYKMSMETPALKPLKEYTSLQRRFRHLTEESLDLIQERVQLEYNK
IAERAACALKLEK
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
atgcagaactattcagtatttgttcccaagctactgcccaaacgtgagttatttgccccc
ggacatcgcgggtgcataggttgcggcgaggctctggcagtccgtctggctaccaaggct
atggatgaaaataccataatagtaaatgccaccggctgtatggaaattatcgcctcccag
tacccctatacctcatggcgtttaccctggatacatacgctgtttgaaaatacagcagca
gttgcctccggtgtggagtcggcgctcaaggtgcttaaacgtaaaaaacggatagaagac
aaggatataaagattgtagccatcgggggtgatggagcaaccgtagatatcgggcttcag
gcactttcgggtgctatggagcgcggccataattttacttatatctgttttgacaatgaa
gcctatatgaacaccggtatccagcgttcttcagctacccccttcggggcagccaccaca
acctcgccggccggcaaggtaggcaaaggccagttttcatggaaaaaggatatgccggct
attgcagttgcccataatatcccgtatgtggccacctgttgccccagctatccctttgac
atgattgaaaaagtcagcaaagctttggcggctgacgggccggcctatatacattgtttg
tctgtttgtcctaccggctggcgctgtgcaaccgaagataccataaagattggacggttg
gcagttgaaaccggtgttttccccctgtacgaggttgttaatggtgagtacaagatgagc
atggaaactcccgcacttaagccattaaaggaatacaccagtcttcagcggcggttccgc
cacctgacagaagaatctctggaccttattcaggaaagagttcagctggaatacaataag
attgcagagagggcggcatgtgcactgaaactagagaaatag

DBGET integrated database retrieval system