KEGG   Dehalococcoides mccartyi GT: DehalGT_0633Help
Entry
DehalGT_0633      CDS       T01182                                 

Definition
(RefSeq) triosephosphate isomerase
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
deg  Dehalococcoides mccartyi GT
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:deg00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    DehalGT_0633
   01230 Biosynthesis of amino acids
    DehalGT_0633
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    DehalGT_0633
   00051 Fructose and mannose metabolism
    DehalGT_0633
   00562 Inositol phosphate metabolism
    DehalGT_0633
Enzymes [BR:deg01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     DehalGT_0633
Exosome [BR:deg04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   DehalGT_0633
  Exosomal proteins of bladder cancer cells
   DehalGT_0633
  Exosomal proteins of melanoma cells
   DehalGT_0633
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
Position
complement(599843..600604)
Genome map
AA seq 253 aa AA seqDB search
MRQIIIAGNWKMNTTLSEACTLVQSMKCELERIEGIEKIICPPFISLYPIKTILENSSIK
LGAQNLFYQEKGAYTGEISPLMLKELCQYVIIGHSERRAYFGETGQVVNQKIKAALQAGL
LPIVCVGEKPEENENGQTRQVLETQLKEALDGLNLSCIIIAYEPIWAIGTGKAATASEAN
SAIGYIRRVLGDTLGNAAAQTSPILYGGSVNEKNITEILSQTNIDGALVGGASLKAESFV
SICRQAAVIQNKH
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atgaggcagattattattgccggaaactggaaaatgaataccactctttccgaagcttgt
acacttgttcagagcatgaaatgcgaacttgagcggatagaaggcattgagaaaataatc
tgcccgccctttatatcgctgtatcccataaaaaccatactggaaaatagcagcatcaaa
ctgggtgctcaaaaccttttctaccaggaaaaaggggcttatacaggtgaaatatcccct
ctgatgctgaaagaactctgccaatacgttattataggccactctgaaagacgggcatat
ttcggtgaaacaggacaggtggtcaatcaaaagataaaggccgctcttcaggcaggccta
ctcccgatagtatgcgtgggcgaaaagcctgaagagaatgaaaacggccaaacccgccaa
gtgctggaaacccagctaaaagaggctctggacgggcttaacctcagctgtatcataata
gcctacgaacccatctgggcaatcggcaccggcaaggccgctaccgcttcagaagccaac
tctgccattggttatatccgccgggtgcttggtgatactctgggcaatgccgcagcccaa
acttctcctatactatatggcggcagtgtaaatgaaaaaaatattaccgaaattctttct
cagacgaatattgacggggctttggtgggtggcgcttctctaaaggctgaatcttttgta
agcatttgccgccaagccgccgttattcaaaataagcactaa

DBGET integrated database retrieval system