KEGG   Dehalococcoides sp. GT: DehalGT_0940Help
Entry
DehalGT_0940      CDS       T01182                                 

Definition
aspartate carbamoyltransferase (EC:2.1.3.2)
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
deg  Dehalococcoides sp. GT
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:deg00240]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:deg00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
898646..899641
Genome map
AA seq 331 aa AA seqDB search
MTHIPKTPADTETLLSEVQGWKHRHVLDLDNFSREELDMVMQTAGVMLDILSRPVKKVPA
LKGKTIATLFYEPSTRTRSSFELAAKSLSADVLNLNVSQSSISKGESLLDTLDTLESLGA
DMVVMRHPLSGAPYLAANNCHANIINAGDGWHAHPSQALLDIFTILRHKSSLEGLKITLI
GDIKHSRVAHSNIWGLSKMGAKITLCAPYTLLPEGLNTNSKIFPEVTLETDIKQAVSGAD
VVMGLRLQRERQQSGLLPGIREYARYFQLNEEILKLAKSNALVMHPGPVNEDIELSQSVV
HGEQSVIKEQVKNGVAVRMALFYLCSGSKEI
NT seq 996 nt NT seq  +upstreamnt  +downstreamnt
atgacacacatacccaagacacccgcagacacagaaaccctgctttcagaagtacaaggc
tggaaacaccgccatgtacttgatctggataacttcagccgtgaagaactggatatggtt
atgcagacagccggcgttatgctggatatcctatcccgcccggtaaagaaagtgccggca
cttaaggggaaaaccatagctacccttttttacgaaccttccacccgtacccgttcatca
tttgagctggcggccaaaagcctttcagccgatgtgttaaacctgaatgtttcccagagc
agtatctccaagggggaaagcctgctggatacgctggatacgctggaatcactgggggcg
gatatggtagtcatgcgccaccccctgtcaggagcgccttatctggcggcaaacaactgc
catgcaaacattataaacgccggtgacggctggcatgcccaccccagtcaggcactgctg
gatatatttaccatactaaggcacaaatccagcttggaagggctgaaaataaccctgata
ggggatataaaacacagccgggtagctcactccaatatctgggggctaagcaaaatggga
gccaaaatcaccctgtgcgccccgtataccctgctacctgaaggacttaataccaatagc
aaaatattccctgaagtcacactggaaacagatataaagcaagcagtcagcggagctgac
gtggtaatggggctgcgcctgcagcgtgaacgccagcaaagcgggcttctgcccggaata
cgggaatatgcccgatacttccaactgaacgaagaaatactgaaactggcaaaatcaaac
gcccttgtcatgcaccccggcccggtaaatgaagatatagaactttcacagtctgtagtg
cacggagaacagtctgtcataaaagaacaggtaaaaaacggggtagcggtacgcatggca
ctcttctatctgtgcagcggaagcaaggaaatataa

DBGET integrated database retrieval system