KEGG   Dehalococcoides mccartyi GT: DehalGT_0965Help
Entry
DehalGT_0965      CDS       T01182                                 

Definition
hypothetical protein
Orthology
K01622  
fructose 1,6-bisphosphate aldolase/phosphatase [EC:4.1.2.13 3.1.3.11]
Organism
deg  Dehalococcoides mccartyi GT
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:deg00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    DehalGT_0965
   01230 Biosynthesis of amino acids
    DehalGT_0965
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    DehalGT_0965
   00030 Pentose phosphate pathway
    DehalGT_0965
   00051 Fructose and mannose metabolism
    DehalGT_0965
  Energy metabolism
   00680 Methane metabolism
    DehalGT_0965
Enzymes [BR:deg01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     DehalGT_0965
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.13  fructose-bisphosphate aldolase
     DehalGT_0965
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
928467..929564
Genome map
AA seq 365 aa AA seqDB search
MKVTLSVIKADIGGFVGHSDSHPQCLARAEKHLAEAKKKGMLIDYHITKCGDDLQLIMTH
QKGINNKVIHEMAWDTFVSCTEVAKELKLYGAGQDLLCDAFSGNVKGMGPGVAEMEIDER
PSEPIIIFMADKTSSGAWNLPLYKMFADPFNTIGLVIAENMHDGFSFEVHDVKESKGITF
NTPEEIYDLLVFIGAPSRFAIKSVSTRKGEIAAVSSTQKLALLAGRYVGKDDPVCIVRAQ
GAFPAVGEILEPFTQPYLVEGWMRGSHNGPIMPVSVEDSTPTRFDGPPRVTALGFQLSNG
MLIGPRDMFKDKSFDNARQKSLDMADMMRSHGPFEPHRLPLEEMEYTTMPQVSKKLAGRF
KPLKD
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtaaccctgagtgttattaaagcagatatcggcggttttgtgggccattcggac
tcacacccgcagtgtctggccagagctgaaaagcatctggcagaagccaaaaagaagggc
atgctgattgattaccacataaccaagtgcggtgacgaccttcagcttatcatgacccac
cagaagggtataaataataaagttatccatgaaatggcatgggatacttttgtaagctgt
accgaagttgccaaagagctgaagctatacggcgccggtcaggacttgctgtgtgatgcc
ttctccggaaacgtaaaaggcatggggcccggtgtagccgaaatggagattgatgaacgg
ccttcagaacctatcatcatcttcatggcagacaaaacctcatccggtgcttggaatctg
cctctttacaagatgtttgcagatccgtttaacactatcggtctggtcatagctgaaaac
atgcatgacggcttttcctttgaagttcatgacgtaaaggaaagcaagggtattaccttt
aatacccctgaagaaatttatgacctgctggtctttatcggcgctccttcccgctttgcc
ataaagagcgtctccacccgcaagggagagattgcggctgtttcctccacccagaagctg
gccctgctggccgggcgctacgtgggcaaagatgatccggtttgtattgtccgcgctcag
ggtgcattcccggctgtgggtgaaatacttgaacccttcactcagccctatctggtagaa
ggctggatgcgcggctcacacaacggccccattatgcctgtctcagtagaggacagcacc
cccacccgctttgacggcccgccccgggtaaccgctttgggcttccaactgtcaaacggc
atgcttattggcccgcgtgatatgttcaaggacaaatcctttgacaacgcccgtcagaag
tcactggacatggcagatatgatgcgctctcacggtccgtttgagccccatcgcctgccc
cttgaggaaatggaatataccaccatgcctcaggtatccaagaaactggccggacgcttt
aaacccctgaaagactag

DBGET integrated database retrieval system