KEGG   Dehalococcoides mccartyi GT: DehalGT_0965Help
Entry
DehalGT_0965      CDS       T01182                                 

Definition
(GenBank) protein of unknown function DUF100
  KO
K01622  fructose 1,6-bisphosphate aldolase/phosphatase [EC:4.1.2.13 3.1.3.11]
Organism
deg  Dehalococcoides mccartyi GT
Pathway
deg00010  Glycolysis / Gluconeogenesis
deg00030  Pentose phosphate pathway
deg00051  Fructose and mannose metabolism
deg00680  Methane metabolism
deg01100  Metabolic pathways
deg01110  Biosynthesis of secondary metabolites
deg01120  Microbial metabolism in diverse environments
deg01130  Biosynthesis of antibiotics
deg01200  Carbon metabolism
deg01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:deg00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    DehalGT_0965
   00030 Pentose phosphate pathway
    DehalGT_0965
   00051 Fructose and mannose metabolism
    DehalGT_0965
  Energy metabolism
   00680 Methane metabolism
    DehalGT_0965
Enzymes [BR:deg01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     DehalGT_0965
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.13  fructose-bisphosphate aldolase
     DehalGT_0965
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FBPase_3
Motif
Other DBs
NCBI-ProteinID: ADC74326
JGI: DehalGT_0965
Position
928467..929564
Genome map
AA seq 365 aa AA seqDB search
MKVTLSVIKADIGGFVGHSDSHPQCLARAEKHLAEAKKKGMLIDYHITKCGDDLQLIMTH
QKGINNKVIHEMAWDTFVSCTEVAKELKLYGAGQDLLCDAFSGNVKGMGPGVAEMEIDER
PSEPIIIFMADKTSSGAWNLPLYKMFADPFNTIGLVIAENMHDGFSFEVHDVKESKGITF
NTPEEIYDLLVFIGAPSRFAIKSVSTRKGEIAAVSSTQKLALLAGRYVGKDDPVCIVRAQ
GAFPAVGEILEPFTQPYLVEGWMRGSHNGPIMPVSVEDSTPTRFDGPPRVTALGFQLSNG
MLIGPRDMFKDKSFDNARQKSLDMADMMRSHGPFEPHRLPLEEMEYTTMPQVSKKLAGRF
KPLKD
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtaaccctgagtgttattaaagcagatatcggcggttttgtgggccattcggac
tcacacccgcagtgtctggccagagctgaaaagcatctggcagaagccaaaaagaagggc
atgctgattgattaccacataaccaagtgcggtgacgaccttcagcttatcatgacccac
cagaagggtataaataataaagttatccatgaaatggcatgggatacttttgtaagctgt
accgaagttgccaaagagctgaagctatacggcgccggtcaggacttgctgtgtgatgcc
ttctccggaaacgtaaaaggcatggggcccggtgtagccgaaatggagattgatgaacgg
ccttcagaacctatcatcatcttcatggcagacaaaacctcatccggtgcttggaatctg
cctctttacaagatgtttgcagatccgtttaacactatcggtctggtcatagctgaaaac
atgcatgacggcttttcctttgaagttcatgacgtaaaggaaagcaagggtattaccttt
aatacccctgaagaaatttatgacctgctggtctttatcggcgctccttcccgctttgcc
ataaagagcgtctccacccgcaagggagagattgcggctgtttcctccacccagaagctg
gccctgctggccgggcgctacgtgggcaaagatgatccggtttgtattgtccgcgctcag
ggtgcattcccggctgtgggtgaaatacttgaacccttcactcagccctatctggtagaa
ggctggatgcgcggctcacacaacggccccattatgcctgtctcagtagaggacagcacc
cccacccgctttgacggcccgccccgggtaaccgctttgggcttccaactgtcaaacggc
atgcttattggcccgcgtgatatgttcaaggacaaatcctttgacaacgcccgtcagaag
tcactggacatggcagatatgatgcgctctcacggtccgtttgagccccatcgcctgccc
cttgaggaaatggaatataccaccatgcctcaggtatccaagaaactggccggacgcttt
aaacccctgaaagactag

DBGET integrated database retrieval system