KEGG   Dehalococcoides sp. GT: DehalGT_1183Help
Entry
DehalGT_1183      CDS       T01182                                 

Definition
indole-3-glycerol-phosphate synthase (EC:4.1.1.48)
Orthology
K01609  
indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
deg  Dehalococcoides sp. GT
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:deg01230]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:deg00400]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1118815..1119594
Genome map
AA seq 259 aa AA seqDB search
MILERIVTDNLPDLERRKMRLPLAKLQELVLDIPYPPIDMAMKLKGRQVRLIAEVKKASP
SKGIIRSDFDPVDIAGIYARNGASAISVLTEEHHFMGSLDNLKKIRESGVASKLPLLRKD
FIHDPYQVYESRLYGADAILLIVAMLSPERLQELLSLSHKLGMKCLVEVHTRSELEIALE
SNARIIGLNNRDLHTFKIDLTVTERLRPLIPPECIVVSESGIQTRADISRLEELGVDAVL
VGEALTASVDIAAKMRELL
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atgattttggaacgtattgtcaccgacaacctgcctgatttggagcggagaaaaatgcgg
ctgccattagcaaaactgcaggaattggtactggacataccctatccacccattgacatg
gccatgaagcttaaagggcggcaggtcaggctgattgccgaggtaaaaaaagcctctccg
tcaaagggtataatccgctcggattttgatccggtggatattgccggcatatatgcccga
aacggggcttccgccatttcggttttgacagaagaacaccattttatgggaagccttgac
aacctgaagaaaatacgcgaatcaggggtggcatcaaagctgccgcttctccgtaaggat
tttatccatgacccgtatcaggtatatgaatcccgcctgtacggggcagacgctattttg
ctgatagtagccatgctgtctcccgaaaggttacaggaactgctttcactcagccataag
ctgggcatgaaatgtctggtggaagtgcatacccggtcagagctggaaatagctttagag
agtaatgcccggattatcggcctgaataaccgtgatttgcatacgtttaaaatagaccta
actgtaaccgaaaggcttcgccccctgataccccctgagtgcatagttgtcagtgaaagc
ggcattcagaccagagcagatatttcccgtctggaagaactgggagtagatgcagtgctg
gtaggagaagccttaacagcctcggttgatattgccgccaaaatgagggaactgctgtga

DBGET integrated database retrieval system