KEGG   Dehalococcoides mccartyi GT: DehalGT_1183Help
Entry
DehalGT_1183      CDS       T01182                                 

Definition
(GenBank) Indole-3-glycerol-phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
deg  Dehalococcoides mccartyi GT
Pathway
deg00400  Phenylalanine, tyrosine and tryptophan biosynthesis
deg01100  Metabolic pathways
deg01110  Biosynthesis of secondary metabolites
deg01130  Biosynthesis of antibiotics
deg01230  Biosynthesis of amino acids
Module
deg_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:deg00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    DehalGT_1183
Enzymes [BR:deg01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     DehalGT_1183
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS QRPTase_C NanE His_biosynth ThiG
Motif
Other DBs
NCBI-ProteinID: ADC74542
JGI: DehalGT_1183
Position
1118815..1119594
Genome map
AA seq 259 aa AA seqDB search
MILERIVTDNLPDLERRKMRLPLAKLQELVLDIPYPPIDMAMKLKGRQVRLIAEVKKASP
SKGIIRSDFDPVDIAGIYARNGASAISVLTEEHHFMGSLDNLKKIRESGVASKLPLLRKD
FIHDPYQVYESRLYGADAILLIVAMLSPERLQELLSLSHKLGMKCLVEVHTRSELEIALE
SNARIIGLNNRDLHTFKIDLTVTERLRPLIPPECIVVSESGIQTRADISRLEELGVDAVL
VGEALTASVDIAAKMRELL
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atgattttggaacgtattgtcaccgacaacctgcctgatttggagcggagaaaaatgcgg
ctgccattagcaaaactgcaggaattggtactggacataccctatccacccattgacatg
gccatgaagcttaaagggcggcaggtcaggctgattgccgaggtaaaaaaagcctctccg
tcaaagggtataatccgctcggattttgatccggtggatattgccggcatatatgcccga
aacggggcttccgccatttcggttttgacagaagaacaccattttatgggaagccttgac
aacctgaagaaaatacgcgaatcaggggtggcatcaaagctgccgcttctccgtaaggat
tttatccatgacccgtatcaggtatatgaatcccgcctgtacggggcagacgctattttg
ctgatagtagccatgctgtctcccgaaaggttacaggaactgctttcactcagccataag
ctgggcatgaaatgtctggtggaagtgcatacccggtcagagctggaaatagctttagag
agtaatgcccggattatcggcctgaataaccgtgatttgcatacgtttaaaatagaccta
actgtaaccgaaaggcttcgccccctgataccccctgagtgcatagttgtcagtgaaagc
ggcattcagaccagagcagatatttcccgtctggaagaactgggagtagatgcagtgctg
gtaggagaagccttaacagcctcggttgatattgccgccaaaatgagggaactgctgtga

DBGET integrated database retrieval system