KEGG   Dehalococcoides mccartyi GT: DehalGT_1186Help
Entry
DehalGT_1186      CDS       T01182                                 

Definition
(GenBank) tryptophan synthase, beta subunit
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
deg  Dehalococcoides mccartyi GT
Pathway
deg00260  Glycine, serine and threonine metabolism
deg00400  Phenylalanine, tyrosine and tryptophan biosynthesis
deg01100  Metabolic pathways
deg01110  Biosynthesis of secondary metabolites
deg01130  Biosynthesis of antibiotics
deg01230  Biosynthesis of amino acids
Module
deg_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:deg00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    DehalGT_1186
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    DehalGT_1186
Enzymes [BR:deg01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     DehalGT_1186
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP DUF1971
Motif
Other DBs
NCBI-ProteinID: ADC74545
JGI: DehalGT_1186
Position
1121254..1122453
Genome map
AA seq 399 aa AA seqDB search
MPKVDSTGKPGYFGKYGGQFVPEILVPVLNELEQAYEQAKKDETFQSRLKSLSNTFSGRP
TPLYLAERLTEHLGGARIYLKREDLAHTGAHKINNALGQGLLALHMGKKRVIAETGAGQH
GVATAAVCAMLGLECIVYMGEDDIKRQALNVFRMKLMGTEVRSVSSGSRTLKDAINEAMR
DWVSNPETTYYIIGSVVGPRPYPAMVRDFQAVIGQETKAQSLRQLGGLPDCIVACVGGGS
NAMGIFYDFIPDQSVRLIGVEAAGSGISTGKHSATLSAGKVGILHGAMSYLLQDEHGQVI
ETHSISAGLDYPGVGPEHSYLKDNKRVEYVSVTDEEALNGFKLLCSLEGIMPALESSHAI
AHALKIAVGMPKNKNIVINLSGRGDKDMDIVQKAMGVKI
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atgcctaaagtagatagcaccggtaaaccggggtatttcggcaagtatggcgggcagttt
gtacctgaaatactggtgccagtcctaaacgaactggaacaggcttatgaacaagccaaa
aaagacgagactttccagtcacgcctgaaatccctttcaaacaccttttcggggcggccc
actccgctgtatctggcagaaaggctgactgaacatctggggggtgccagaatttacctg
aaaagggaagacctggcccatacaggtgcccataaaatcaacaacgcactcggtcagggg
ctgcttgccttgcatatgggaaagaaaagggtaattgccgaaacaggggcggggcaacac
ggggtagccaccgcagctgtttgcgccatgctggggctggaatgcattgtctatatgggc
gaagatgacatcaaacgtcaagccttgaacgtattccgcatgaagctgatgggaacggaa
gtcagaagcgtatcttcgggcagccgtaccctgaaagacgccatcaatgaagctatgcgt
gactgggtaagcaacccggagaccacttattatataatcggttcggtggtcggcccgcgc
ccttatccggctatggtacgggattttcaggcagttatcgggcaggaaaccaaagcccag
tccttaagacagctggggggactacctgactgcattgttgcctgtgttggcggaggcagc
aatgccatgggtattttctatgatttcataccagaccaaagcgtacgtcttatcggggtg
gaagctgccggcagcggcatcagcaccggcaaacattcggccacccttagtgccggcaag
gtgggtatactccacggcgccatgtcctacctgcttcaggacgagcatggacaggtgatt
gaaacccacagtatttcggccgggctggattatcccggcgtaggacctgaacacagctac
ctgaaagataataagcgggtggaatatgtttcggtcacagatgaagaagccctgaacggc
ttcaaactgctatgctcgctggaagggataatgcctgctctggaatcttcccacgccatt
gcccatgccctgaaaatagcagtcggcatgccgaaaaacaaaaatatagtcataaacctc
tccggcagaggggacaaagacatggatattgttcaaaaagcaatgggggtaaagatatga

DBGET integrated database retrieval system