KEGG   Dehalococcoides mccartyi GT: DehalGT_1397Help
Entry
DehalGT_1397      CDS       T01182                                 

Definition
dihydropteroate synthase (EC:2.5.1.15)
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
deg  Dehalococcoides mccartyi GT
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:deg00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    DehalGT_1397
Enzymes [BR:deg01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     DehalGT_1397
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1327503..1328351
Genome map
AA seq 282 aa AA seqDB search
MNLPITKPASSHFGSKQFGWGERTYIMGIVNVTPDSFSGDGLGANPEAALEQARRFAKEG
ADILDIGGESTRPNCPPVSTEEELGRVIPAIRLIVRNLDIPISIDTYRREVAEEALKAGA
CIVNDVWSLQKDPSLFELAAKSRAGWVITSNQREHPVEDIMEAVTCELKSTALKLLELGV
PAQNIIIDPGVGFGKTLEQNLEIVRRLSELKTLNLPVLLGTSRKSLIGQVLDTPPNERLE
GTAATVALGIGGGVDIVRVHDVARMRRVCQMSDAVIRGKIWK
NT seq 849 nt NT seq  +upstreamnt  +downstreamnt
atgaatttacccattacaaaacccgcaagcagccacttcggctcaaagcaatttggctgg
ggagagcgtacctatataatgggcattgtaaatgtcactccggactcattttcgggtgac
ggactgggtgctaaccccgaagcggcactggaacaggcccgccgctttgcaaaagaaggg
gcggatatactggatataggcggtgaaagtacccgcccgaactgcccgcctgtaagcacc
gaagaagaactggggcgggtaattccggctatacgtcttatagtgcggaatctggatatc
cccataagcatagatacctaccgccgtgaagtggctgaggaagccctgaaggcgggtgcc
tgcatagtaaatgatgtctggagtttacaaaaagacccttcactttttgaactggcggcc
aaaagccgagctggctgggtaataacctctaaccagcgggaacaccctgtggaagacatt
atggaggcagtcacctgcgaactgaaatctaccgccctgaaactgctggagctgggtgta
ccagcccaaaatattataattgacccgggggtgggtttcggtaaaactttggaacagaat
ctggagattgtccgccgtctgtcagaactgaaaacccttaatctgcctgtactgctgggt
acttcccgcaaatccctgatagggcaggtgctggataccccgcctaacgaacggcttgaa
ggcacggccgccaccgttgccctggggatagggggaggggtagatattgtaagggtgcat
gacgtggcccggatgagacgggtctgccagatgagcgatgctgttataaggggtaaaata
tggaaataa

DBGET integrated database retrieval system