KEGG   Dehalococcoides mccartyi CBDB1: cbdb_A1008Help
Entry
cbdb_A1008        CDS       T00273                                 

Definition
(RefSeq) tryptophan synthase subunit beta (EC:4.2.1.20)
  KO
K06001  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
deh  Dehalococcoides mccartyi CBDB1
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:deh00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    cbdb_A1008
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    cbdb_A1008
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    cbdb_A1008
Enzymes [BR:deh01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     cbdb_A1008
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
814574..815938
Genome map
AA seq 454 aa AA seqDB search
MVQTKFILQEKDMPQVWYNIQPDLPVPLPPVLHPGTGKPVTPADMEAIFPMNLIMQEFSP
ERHIPIPEELLELYKIWRPTPLYRAHRLEKALQTPAKIFYKLEDVSPAGSHKPNTALAQA
YYNKQAGIKRISTETGAGQWGSSLAMACKFFDIECKVYMVKVSYNMKPYRRIMMETWGAS
VVPSPSPDTRIGREILERDPECPGSLGIAISEAVEDAVTHPGTKYALGSVLNHVLLHQTI
IGQEAKKQMAMADCYPDIVIGCVGGGSNFGGIAIPFVEDKLNGTHKDTRILAVEPASCPS
LTKGLDAYDFGDEAGMTPMMKMFTLGHQFMPPPVHAGGLRYHGMSPLLSHLSRLKLIEAT
AVQQIETFEAGMQFAQTEGFISAPETNHAIRATIDEALKCRETGEAKTILFCHSGHGHVD
MASYDLYLRGKLSNYEYPAELVKEAQKGLPKVNV
NT seq 1365 nt NT seq  +upstreamnt  +downstreamnt
atggttcaaaccaagttcatactgcaggaaaaggatatgcctcaggtctggtacaatatc
cagcctgatttgcccgtaccgctgcctcctgttttgcatccgggcaccggcaagccggtc
actccggctgatatggaagctatattccctatgaaccttatcatgcaggagttcagcccc
gaaaggcatatacccatcccggaagaactgttggaactatataaaatctggcggccaacc
cctctttaccgtgcccaccgactggaaaaggctttgcagactccggctaaaatattttac
aaactggaagatgtcagcccggccggttcacacaaacccaataccgccctggctcaggct
tattacaataaacaagccggcataaagcggatttccaccgaaaccggcgccggacaatgg
ggttcttctctggctatggcttgcaaattctttgacatagagtgcaaggtctatatggta
aaggtaagctacaatatgaaaccttaccgccgcattatgatggaaacctggggtgcctct
gtcgtacccagccccagcccggatacccgaataggccgtgagatactggaacgtgacccc
gaatgccccggcagtttgggtattgccataagcgaagctgtggaagatgctgtaacccat
cccggcaccaagtatgctctgggtagtgtacttaaccatgtactccttcaccagactatt
atcggtcaggaagctaaaaagcagatggccatggcagactgctaccctgatattgttatt
ggctgtgttggcggcggttcaaactttggcggtatcgctataccctttgtggaagacaaa
ctgaacggtactcacaaggatacccgcattttggcagttgagcccgccagctgtccttca
ctgaccaagggtctggacgcctatgacttcggagacgaagccggtatgacccctatgatg
aaaatgtttacgctgggtcaccagtttatgccacctccggtacatgccggcgggttgcgg
tatcacggcatgtctcccctgctgtctcacctcagccgcctgaagctgattgaggctaca
gcggttcagcagatagagacctttgaagcgggcatgcagtttgcccagactgaaggcttc
ataagcgcacctgaaaccaaccatgccatcagggctacaattgatgaagccctgaaatgc
cgcgaaaccggcgaagccaagactattctcttctgccacagcggtcacggccacgtggac
atggcttcttacgacctgtacctgcggggcaagctcagtaactacgaatacccggcagaa
ctggtaaaagaggctcagaagggtttgcctaaagtcaacgtctag

DBGET integrated database retrieval system