KEGG   Dehalococcoides mccartyi CBDB1: cbdb_A1179Help
Entry
cbdb_A1179        CDS       T00273                                 

Gene name
argJ
Definition
bifunctional ornithine acetyltransferase/N-acetylglutamate synthase (EC:2.3.1.1 2.3.1.35)
Orthology
K00620  
glutamate N-acetyltransferase / amino-acid N-acetyltransferase [EC:2.3.1.35 2.3.1.1]
Organism
deh  Dehalococcoides mccartyi CBDB1
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Module
Ornithine biosynthesis, glutamate => ornithine
Brite
KEGG Orthology (KO) [BR:deh00001]
 Metabolism
  Overview
   01210 2-Oxocarboxylic acid metabolism
    cbdb_A1179 (argJ)
   01230 Biosynthesis of amino acids
    cbdb_A1179 (argJ)
  Amino acid metabolism
   00330 Arginine and proline metabolism
    cbdb_A1179 (argJ)
Enzymes [BR:deh01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.1  amino-acid N-acetyltransferase
     cbdb_A1179 (argJ)
    2.3.1.35  glutamate N-acetyltransferase
     cbdb_A1179 (argJ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
950977..952194
Genome map
AA seq 405 aa AA seqDB search
MKSSIDILPDGSITTPKGFKAGAIYAGIKKKSKNNLDLAILYSDTPCIAAGIFTTNKFRA
APVYISEHNLGFTDNRAIVVNSGCANAGTGEAGMADAIEMVKATAESLNMQPKDVLIAST
GVIGHRLPIDKIKENVRLIGLSQRNGHEFARAIMTTDTRSKEIAVQVNIEGFQFYIAGAA
KGAGMIHPNMATMLGFITTDASVSKEFLQFALKEAADVSFNMITVDGDTSTNDSLFMLSN
GQAENPTFAGNTEYSLVFQQALTIVCQNLAKSIARDGEGAKRLIEIQVEGAANLEDARLI
ARVIAGSPLVKTAVHGADPNWGRILAAAGRAGADFDIDMVDLYLGESPVLLKGARTGVDE
KELSSWLRQVEVIIKLNLNLGQGKAAAWGCDLSAEYVKINADYTT
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
atgaaaagcagtatagatattttgcctgatggcagcattaccacacccaaaggttttaaa
gccggtgcgatttatgccggtatcaagaaaaaatccaagaacaatttggatctggctatc
ttatattcagacacaccctgcattgccgcaggcatatttaccaccaataaattccgggct
gccccggtgtatatttcagaacacaatctgggcttcaccgataaccgggccattgtagtc
aacagcggttgtgccaacgcgggcacaggcgaagccggcatggcagatgccattgaaatg
gtgaaagccacagctgaaagcctgaatatgcaacccaaagacgtactgatagcttctacc
ggggttatcggacaccgcctgcctatagataaaataaaggaaaatgtccgcctgataggt
ctttcccaacgcaacgggcatgaatttgcccgggctattatgaccaccgacacccgcagt
aaagagattgcggtacaggtaaatatagagggtttccagttttatatagccggcgctgcc
aaaggggcaggcatgattcaccctaatatggctactatgctgggttttataactacagac
gcatctgtaagcaaagagtttttgcagtttgcccttaaagaagcggctgacgtcagcttc
aatatgataactgtagatggtgacacatctaccaatgacagcctttttatgctctccaac
gggcaagcggaaaaccccacctttgccggaaatactgaatattcactggtattccagcag
gcacttaccattgtctgccaaaatctggctaaaagcattgccagagacggcgaaggcgcc
aaacggctgattgaaatacaggtggagggcgcagccaatctggaagatgccagactgatt
gcccgcgtaatagccggctcacccctggtaaaaactgccgtccacggggcagatcccaac
tggggacggatactggcagctgccggacgggccggggctgattttgatatagacatggta
gacctgtaccttggggaaagcccggtactccttaagggtgcacgcacaggcgtggacgaa
aaggaactttcttcgtggcttagacaggtagaggttattataaagcttaaccttaacctt
ggtcagggtaaagctgctgcctggggctgtgacctttcagccgaatatgtaaaaataaat
gcagactacactacttaa

DBGET integrated database retrieval system