KEGG   Dehalococcoides mccartyi CBDB1: cbdb_A1212Help
Entry
cbdb_A1212        CDS       T00273                                 

Gene name
proB
Definition
gamma-glutamyl kinase (EC:2.7.2.11)
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
deh  Dehalococcoides mccartyi CBDB1
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:deh00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    cbdb_A1212 (proB)
  Amino acid metabolism
   00330 Arginine and proline metabolism
    cbdb_A1212 (proB)
Enzymes [BR:deh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     cbdb_A1212 (proB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
979137..980258
Genome map
AA seq 373 aa AA seqDB search
MNENCYKRVVIKLGTSLLTGGTGKLDHERMADLCRQIAELTRLGTEIVIVSSGAIAAGRS
KMGIRHIPKDVPFKQVLAAIGQSQLMNYYDQLFSPHGLTVAQGLLTKSDLSDRSGYLNAR
NTLLALMELGIITIVNENDVVAIDEIQQAKFGDNDNLSAMVANLIEADLLLILTNIRGLY
TSDPTLHPEATLITEVKEITEELEQLAAGSSNKLGTGGMVTKLEAARLATSSGVTAIIAD
GHIPDIILKLANGENEGTRFIPSLHKPDSRQRWMMSGLCTRGSICVDDGAAKALRENQKS
LLAAGVQQAEGKFGRGDIVKLTDSHGKRLGYGITNYSSDDISKIKGLHSQELNAVLGGNQ
GPEVIHRNNLVVI
NT seq 1122 nt NT seq  +upstreamnt  +downstreamnt
atgaacgaaaattgttataaacgggttgtaataaagttgggcaccagtctgctcaccggc
ggcacaggcaagcttgaccatgagcgcatggctgacctgtgccgacagatagccgaactg
acccgcctgggtactgagatagttatagtttcttcgggggctattgccgccggacgctct
aaaatgggtatccgccacattccgaaagatgttccttttaaacaagtgctggccgccata
ggccagagccagcttatgaattattatgaccagttattcagtcctcacgggctgacggtt
gcccaaggtctgctgaccaaaagtgacctgtctgaccgttcgggttacctcaacgcccga
aataccctgctggctttgatggaactgggaattataaccattgtcaatgaaaatgacgtg
gtagcaatagatgaaatccagcaagccaaatttggggataatgacaatctgtcggccatg
gtagccaacctgatagaggctgatttactgctgatactgaccaatatccgcgggctttac
acctcagaccctactctccaccctgaagctaccctgataaccgaggtcaaagagattacc
gaagaactggagcaactggccgccggcagctcaaacaagctgggtacaggcggaatggta
accaaactggaagccgccagactggccacatcttcaggggtaaccgccattattgcagac
gggcatataccggatattattctcaaactggcgaatggtgaaaatgaaggtacccgtttt
ataccttcactgcacaagccggatagccgccagcgctggatgatgagcgggctttgcacc
cgcggcagcatctgtgtagatgacggggcagccaaagcactaagagaaaaccagaaaagc
ctgctggctgccggagtgcaacaggccgaaggcaaattcgggcggggtgatattgtaaag
cttaccgacagccacggaaaacggctgggttatggcataaccaattactcttcagatgat
atttccaaaataaaaggccttcactcacaggaactaaacgccgttttagggggcaaccaa
ggccctgaagtaatacaccgcaataatctggtggtaatttaa

DBGET integrated database retrieval system