KEGG   Dehalococcoides mccartyi CBDB1: cbdb_A1296Help
Entry
cbdb_A1296        CDS       T00273                                 

Definition
carbohydrate kinase
Orthology
K16370  
6-phosphofructokinase 2 [EC:2.7.1.11]
Organism
deh  Dehalococcoides mccartyi CBDB1
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:deh00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    cbdb_A1296
   01230 Biosynthesis of amino acids
    cbdb_A1296
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    cbdb_A1296
   00030 Pentose phosphate pathway
    cbdb_A1296
   00051 Fructose and mannose metabolism
    cbdb_A1296
   00052 Galactose metabolism
    cbdb_A1296
  Energy metabolism
   00680 Methane metabolism
    cbdb_A1296
Enzymes [BR:deh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     cbdb_A1296
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1027908..1028840
Genome map
AA seq 310 aa AA seqDB search
MIATVTLNPCLDKHIDVHGLVLYETNRWHRMSKYAGGKGIDVSRAVYEMGFDTIACGLLG
GEEGREIETLLTEQGLKYHFTPISQPTRSCFIIYDTKTHRQTNLNAPGPRIAPPELKMFY
EDLLRESAASSLIVMSGSVPPGVPSSVYFTLISHARKLGKQTILDTAGKYLREGLKAKPC
LVKPNIREAEELLGRKLETEAEIILAAKEIVRMGAGIEVISMGKKGLIACDGKQVIKASS
AYVRVKSTVGAGDSTVAGFAISLRRGDSLEEACRLGVAMGTAAVMTPGTELCHREDVQYW
LPRIKIRRLA
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
gtgattgccacggttactttaaacccctgcctggacaagcatatagatgtgcatggtttg
gtactatatgaaaccaaccgctggcatcgcatgtccaaatatgccggcggcaaagggata
gatgtttcacgtgccgtctacgaaatggggtttgatacaattgcctgcggtttgctgggg
ggagaggaagggcgggaaattgaaaccctgttgacagagcaagggctaaaatatcacttt
acccccataagccagcctacccgcagttgttttataatttacgataccaaaacccaccgc
cagactaatctgaacgcccccggtccgcgaatagctccgcctgaactaaaaatgttttat
gaagacctgctgagggaaagtgctgcttccagcctgattgttatgtcgggaagcgtgccg
ccgggagtgccgtcaagtgtctatttcacccttatcagccacgcccgcaaactgggcaaa
caaaccatactggataccgccggtaaatacctgcgggaagggctgaaggctaaaccctgt
ctggtcaagcccaacatccgcgaagcagaggaactgttgggcagaaaactggagactgag
gctgaaataatactggctgccaaagaaatagtccggatgggggcaggaatagaggtaatc
tccatgggtaaaaaggggctgatagcctgtgacggaaagcaagtaataaaggcaagttcg
gcttatgtgcgggtaaaaagtacggtgggagcaggggattcaaccgtggccggttttgct
atatcactccgccgcggagacagcctggaagaagcttgccgtttgggggtagctatgggc
acagctgccgtaatgactcccggtactgaactctgccaccgtgaagacgttcagtattgg
ctgccccggataaaaatccgccgtctggcttag

DBGET integrated database retrieval system