KEGG   Dehalococcoides sp. CBDB1: cbdb_A1696Help
Entry
cbdb_A1696        CDS       T00273                                 

Gene name
folP
Definition
dihydropteroate synthase (EC:2.5.1.15)
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
deh  Dehalococcoides sp. CBDB1
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:deh00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1362868..1363716
Genome map
AA seq 282 aa AA seqDB search
MNLPITKPVSSHFGSKQFGWGERTYIMGIVNVTPDSFSGDGLGANPEAALEQARRFAKEG
ADILDIGGESTRPNCPPVSTEEELGRVILAIRLIVRNLDIPISIDTYRREVAEEALKAGA
CIVNDVWGLQKDPSLFELAAKSRAGWVITSNQREHPVEDIMKAVTCELKSTALKLLELGV
PAQNIIIDPGVGFGKTLEQNLEIVRRLSELKTLNLPVLLGTSRKSLIGQVLDTPPNERLE
GTAATVALGIGGGVDIVRVHDVARMRRVCQMSDAVIRGKIWK
NT seq 849 nt NT seq  +upstreamnt  +downstreamnt
atgaatttacccattacaaaacccgtaagcagccacttcggctcaaagcaatttggctgg
ggagagcgtacctatataatgggcattgtaaatgtcactccggactcattttcgggtgac
ggactgggtgctaaccccgaagcggcactggaacaagcccgccgctttgcaaaagaaggg
gcggatatactggatataggcggtgaaagtacccgcccgaactgcccgcctgtaagcacc
gaagaagaactgggacgggtaattctggctatacgtcttatagtgcggaatctggatatc
cccataagcatagatacctaccgccgtgaagtggctgaggaagccctgaaggcgggtgcc
tgcatagtaaatgatgtttggggtttacaaaaagacccttcactttttgaactggcggcc
aaaagccgagctggctgggtaataacctctaaccagcgggaacaccctgtggaagacatt
atgaaggcagtcacctgcgaactgaaatctaccgccctgaaactgctggagctgggtgta
ccagcccaaaatattataattgacccgggggtgggtttcggtaaaactttggaacagaat
ctggagattgtccgccgtctgtcagaactgaaaacccttaatctgcctgtactgctgggt
acttcccgcaaatccctgatagggcaggtgctggataccccgcctaacgaacggcttgaa
ggcacggccgccaccgttgccctggggatagggggaggggtagatattgtaagggtgcat
gacgtggcccggatgagacgggtctgccagatgagcgatgctgttataaggggtaaaata
tggaaataa

DBGET integrated database retrieval system