KEGG   Dehalococcoides mccartyi CBDB1: cbdb_A1741Help
Entry
cbdb_A1741        CDS       T00273                                 

Definition
L-fuculose phosphate aldolase (EC:4.1.2.17)
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
deh  Dehalococcoides mccartyi CBDB1
Pathway
Fructose and mannose metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:deh00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    cbdb_A1741
Enzymes [BR:deh01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     cbdb_A1741
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1393954..1394535
Genome map
AA seq 193 aa AA seqDB search
MNGQTPSETLHWFIQAGKLLFGRGLVSSHSGNLSQRWKDKLYITRTGSSLPLFSEIDLIL
TGLDHNDQFTPLASSELPVHRAIYRRTSAKAIVHAHPPYAAALSLLEGEIIPDCGEGLYC
LGTIPVIGFGERVHPGSLAEEVATALETHRVIVVAGHGSFATGENIEEALKYTFALEEMC
QVTYLARILKKAD
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
ttgaacggtcaaacaccttctgaaaccctgcattggtttatacaggctggaaaactgctt
ttcgggcggggactggtttcctcacactccggcaacctcagccaacgatggaaagacaag
ctttacataacccgaaccggcagttcactgcctctttttagcgaaatagacctgatactg
accggtcttgaccataatgaccagtttaccccgcttgcctcaagcgaactgcccgttcac
cgggctatttaccgccgcacatccgccaaagccatagttcatgctcacccgccttatgcg
gccgctctctccctgcttgagggggaaataataccggactgcggtgaggggctttactgc
ctgggaactataccggttatcggtttcggagagcgggttcatcccggcagtctggcagaa
gaagtggctacagcactggaaacacaccgggttatagtggtagccggtcatggcagcttt
gcaacaggggaaaacatagaagaagccctgaaatacactttcgctttggaagaaatgtgc
caggtaacctatctggctcgtatcctcaagaaagctgactaa

DBGET integrated database retrieval system