KEGG   Dehalococcoides sp. CBDB1: cbdb_A1741Help
Entry
cbdb_A1741        CDS       T00273                                 

Definition
L-fuculose phosphate aldolase (EC:4.1.2.17)
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
deh  Dehalococcoides sp. CBDB1
Pathway
Fructose and mannose metabolism
Class
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:deh00051]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1393954..1394535
Genome map
AA seq 193 aa AA seqDB search
MNGQTPSETLHWFIQAGKLLFGRGLVSSHSGNLSQRWKDKLYITRTGSSLPLFSEIDLIL
TGLDHNDQFTPLASSELPVHRAIYRRTSAKAIVHAHPPYAAALSLLEGEIIPDCGEGLYC
LGTIPVIGFGERVHPGSLAEEVATALETHRVIVVAGHGSFATGENIEEALKYTFALEEMC
QVTYLARILKKAD
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
ttgaacggtcaaacaccttctgaaaccctgcattggtttatacaggctggaaaactgctt
ttcgggcggggactggtttcctcacactccggcaacctcagccaacgatggaaagacaag
ctttacataacccgaaccggcagttcactgcctctttttagcgaaatagacctgatactg
accggtcttgaccataatgaccagtttaccccgcttgcctcaagcgaactgcccgttcac
cgggctatttaccgccgcacatccgccaaagccatagttcatgctcacccgccttatgcg
gccgctctctccctgcttgagggggaaataataccggactgcggtgaggggctttactgc
ctgggaactataccggttatcggtttcggagagcgggttcatcccggcagtctggcagaa
gaagtggctacagcactggaaacacaccgggttatagtggtagccggtcatggcagcttt
gcaacaggggaaaacatagaagaagccctgaaatacactttcgctttggaagaaatgtgc
caggtaacctatctggctcgtatcctcaagaaagctgactaa

DBGET integrated database retrieval system