KEGG   Dehalococcoides sp. CBDB1: cbdb_A595Help
Entry
cbdb_A595         CDS       T00273                                 

Definition
ELP3 family histone acetyltransferase
Orthology
K07739  
elongator complex protein 3 [EC:2.3.1.48]
Organism
deh  Dehalococcoides sp. CBDB1
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
487987..489366
Genome map
AA seq 459 aa AA seqDB search
MKKLSRTISGVTPVAVMTKPLPCPGKCIYCPTFAATPQSYTPESPAVLRAKSCEYQAYKQ
VALRLRIIQDMGHPTDKVELIIMGGTFLSADITYQYGFIKDCYDALNGVVAGSLEEAKTI
NETAQHRCVGLCIETRPDICGKAEIQRMIDFGTTRVELGVQMLDDDIYKLVERGHRVSDV
AEATCLLREYGLKVHYHWMPGLPGSSPEKDLALSRMVFEDPRFCPDGLKLYPTMVVEGTI
LEQWWKEGRYTPYPNGTMTGLIADIKALVPPYVRISRVLRDIPAVFISAGLKDSLRDGVR
QILESRHQKCRCIRCREYGHRQRKGQTSGEPTLRRLDYPASGGKEIFLSFEDASDTLYGL
LRLRIPCASLPVLGQKYGAKTGLVRELHVYGTELSLGEQGDQSAQHRGLGRKLLAEAECL
ARDEFGLDSLAILSGVGAREYYRSLGYELVAGYMCKHLD
NT seq 1380 nt NT seq  +upstreamnt  +downstreamnt
atgaagaagctttcccgaacaatatcaggtgttaccccggtggcggttatgaccaagccg
ctaccatgccccggcaagtgcatttattgccccacttttgccgctactccccaaagctat
acacctgaatctccggctgttttgcgggctaaaagctgtgaataccaggcttataaacag
gttgcccttcgcctgaggataatacaggacatgggacaccctacggataaggttgagctt
ataatcatgggtggcactttcctttcggcagatatcacttaccagtacggctttattaaa
gattgctacgacgctttgaacggagtggtggccggcagtctggaagaagccaaaaccata
aatgaaaccgcccagcaccgctgtgtgggtttatgtattgaaacccgtccggatatttgc
gggaaggccgaaatacaacggatgatagatttcgggactaccagagtggaacttggcgtc
cagatgctggatgatgatatttataagctggttgaacggggacatagggtttcagatgtg
gctgaggctacgtgtcttctgcgtgaatacggccttaaagtgcattaccactggatgccc
ggacttcccggctcttctcctgaaaaagatctggcactttcccggatggtgtttgaagac
ccgcggttttgccctgacgggcttaagctttatcccactatggtagtggaaggaactata
ctagaacagtggtggaaagagggaaggtacaccccctatcccaatggcaccatgaccggg
ctgattgcggatatcaaagcactggtgccgccttacgtgcgtatttcacgggtacttcgg
gatataccggctgtatttattagcgccggcctcaaagactccctgagggacggggttcgc
cagatactggaaagccgccaccagaagtgcaggtgcatacgttgccgtgaatacggccac
cgccagcggaaagggcagaccagcggtgaacctaccttaaggcgtcttgattatcctgcc
tcaggtggcaaggagatattccttagctttgaagatgcctctgacactctgtatggtctg
ctcagattgcgtataccctgtgcatcgctgcctgttctgggtcagaaatatggtgctaaa
acagggctggtgcgtgaactgcatgtgtatggcacagaactttcacttggggaacaggga
gaccagtctgcccagcaccggggtcttggacggaaactgctggcggaagcggagtgttta
gcccgtgatgaattcggtcttgactcactggctattttaagcggggtgggtgccagagag
tattacaggtcactggggtatgaactggtggctgggtatatgtgcaagcacttagactga

DBGET integrated database retrieval system